eF-site ID 4r7t-ABC PDB Code 4r7t Chain A, B, C click to enlarge Title Crystal structure of glucosamine-6-phosphate deaminase from Vibrio cholerae Classification HYDROLASE Compound Glucosamine-6-phosphate deaminase Source Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (NAGB_VIBCH) Sequence A:  MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLP TGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAAD HPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKR YEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIK TLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDAQEIM ILVTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCD EPSTQELKVKTVKYFTELEAKNIVGF B:  MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLP TGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAAD HPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKR YEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIK TLTEDTRIANSFFDGDINQVPKYALTIGVGTLLDAQEIMI LVTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCDE PSTQELKVKTVKYFTELEAKNIVGF C:  MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLP TGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAAD HPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKR YEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIK TLTEDTRIANSRFFDINQVPKYALTIGVGTLLDAQEIMIL VTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCDEP STQELKVKTVKYFTELEAKNIVGF Description Functional site 1) chain A residue 97 type sequence I description BINDING SITE FOR RESIDUE MG A 301 source : AC1 2) chain B residue 112 type sequence D description BINDING SITE FOR RESIDUE MG A 301 source : AC1 3) chain A residue 140 type sequence N description BINDING SITE FOR RESIDUE CL A 302 source : AC2 4) chain A residue 254 type sequence Y description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 5) chain C residue 141 type sequence D description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 6) chain C residue 149 type sequence P description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 7) chain B residue 97 type sequence I description BINDING SITE FOR RESIDUE MG B 300 source : AC4 8) chain C residue 112 type sequence D description BINDING SITE FOR RESIDUE MG B 300 source : AC4 9) chain B residue 43 type sequence G description BINDING SITE FOR RESIDUE FMT B 301 source : AC5 10) chain B residue 44 type sequence T description BINDING SITE FOR RESIDUE FMT B 301 source : AC5 11) chain A residue 112 type sequence D description BINDING SITE FOR RESIDUE MG C 300 source : AC6 12) chain C residue 97 type sequence I description BINDING SITE FOR RESIDUE MG C 300 source : AC6 13) chain A residue 72 type ACT_SITE sequence D description Proton acceptor; for enolization step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI1 14) chain B residue 72 type ACT_SITE sequence D description Proton acceptor; for enolization step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI1 15) chain C residue 72 type ACT_SITE sequence D description Proton acceptor; for enolization step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 141 type ACT_SITE sequence D description For ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 148 type ACT_SITE sequence E description For ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI2 18) chain B residue 141 type ACT_SITE sequence D description For ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI2 19) chain B residue 148 type ACT_SITE sequence E description For ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI2 20) chain C residue 141 type ACT_SITE sequence D description For ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI2 21) chain C residue 148 type ACT_SITE sequence E description For ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 143 type ACT_SITE sequence H description Proton acceptor; for ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI3 23) chain B residue 143 type ACT_SITE sequence H description Proton acceptor; for ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI3 24) chain C residue 143 type ACT_SITE sequence H description Proton acceptor; for ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI3 25) chain A residue 151 type SITE sequence S description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 26) chain A residue 158 type SITE sequence R description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 27) chain B residue 151 type SITE sequence S description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 28) chain B residue 158 type SITE sequence R description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 29) chain B residue 160 type SITE sequence K description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 30) chain B residue 161 type SITE sequence T description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 31) chain B residue 254 type SITE sequence Y description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 32) chain C residue 151 type SITE sequence S description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 33) chain C residue 158 type SITE sequence R description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 34) chain C residue 160 type SITE sequence K description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 35) chain C residue 161 type SITE sequence T description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 36) chain C residue 254 type SITE sequence Y description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 37) chain A residue 160 type SITE sequence K description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 38) chain A residue 161 type SITE sequence T description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 39) chain A residue 254 type SITE sequence Y description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 40) chain A residue 125-143 type prosite sequence IKSYGKINLFMGGVGNDGH description GLC_GALNAC_ISOMERASE Glucosamine/galactosamine-6-phosphate isomerases signature. IksyGkInLfMgGVGnDGH source prosite : PS01161

Display surface Download Links