eF-site ID 4r7t-A PDB Code 4r7t Chain A click to enlarge Title Crystal structure of glucosamine-6-phosphate deaminase from Vibrio cholerae Classification HYDROLASE Compound Glucosamine-6-phosphate deaminase Source Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (NAGB_VIBCH) Sequence A:  MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLP TGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAAD HPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKR YEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIK TLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDAQEIM ILVTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCD EPSTQELKVKTVKYFTELEAKNIVGF Description Functional site 1) chain A residue 97 type sequence I description BINDING SITE FOR RESIDUE MG A 301 source : AC1 2) chain A residue 140 type sequence N description BINDING SITE FOR RESIDUE CL A 302 source : AC2 3) chain A residue 254 type sequence Y description BINDING SITE FOR RESIDUE GOL A 303 source : AC3 4) chain A residue 112 type sequence D description BINDING SITE FOR RESIDUE MG C 300 source : AC6 5) chain A residue 72 type ACT_SITE sequence D description Proton acceptor; for enolization step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 141 type ACT_SITE sequence D description For ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 148 type ACT_SITE sequence E description For ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 143 type ACT_SITE sequence H description Proton acceptor; for ring-opening step => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI3 9) chain A residue 151 type SITE sequence S description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 10) chain A residue 158 type SITE sequence R description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 11) chain A residue 160 type SITE sequence K description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 12) chain A residue 161 type SITE sequence T description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 13) chain A residue 254 type SITE sequence Y description Part of the allosteric site => ECO:0000255|HAMAP-Rule:MF_01241 source Swiss-Prot : SWS_FT_FI4 14) chain A residue 125-143 type prosite sequence IKSYGKINLFMGGVGNDGH description GLC_GALNAC_ISOMERASE Glucosamine/galactosamine-6-phosphate isomerases signature. IksyGkInLfMgGVGnDGH source prosite : PS01161

Display surface Download Links