eF-site ID 4r4q-A PDB Code 4r4q Chain A click to enlarge Title Crystal structure of RPA70N in complex with 5-(3-((N-(4-(5-carboxyfuran-2-yl)benzyl)acetamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1H-pyrazole-3-carboxylic acid Classification PROTEIN BINDING Compound Replication protein A 70 kDa DNA-binding subunit Source Homo sapiens (Human) (RFA1_HUMAN) Sequence A:  HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSP PRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQI HRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYN E Description Functional site 1) chain A residue 33 type sequence I description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 2) chain A residue 34 type sequence T description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 3) chain A residue 41 type sequence R description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 4) chain A residue 55 type sequence S description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 5) chain A residue 57 type sequence M description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 6) chain A residue 59 type sequence A description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 7) chain A residue 60 type sequence T description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 8) chain A residue 85 type sequence N description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 9) chain A residue 87 type sequence L description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 10) chain A residue 91 type sequence R description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 11) chain A residue 93 type sequence V description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 12) chain A residue 95 type sequence I description BINDING SITE FOR RESIDUE 3HZ A 201 source : AC1 13) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0007744|PubMed:19413330, ECO:0007744|PubMed:22223895 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 88 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:26474068 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 22 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:26474068 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links