eF-site ID 4qy5-A PDB Code 4qy5 Chain A click to enlarge Title Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations Classification HYDROLASE Compound Beta-lactamase TEM,Beta-lactamase PSE-4 Source Escherichia coli (BLAT_ECOLX) Sequence A:  HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER FPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEY SPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGP KELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKA IASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSAL PAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTG SQATMDERNRQIAEIGASLIKHW Description Functional site 1) chain A residue 93 type sequence R description BINDING SITE FOR RESIDUE CL A 301 source : AC1 2) chain A residue 174 type sequence L description BINDING SITE FOR RESIDUE CL A 301 source : AC1 3) chain A residue 218 type sequence G description BINDING SITE FOR RESIDUE CL A 302 source : AC2 4) chain A residue 219 type sequence P description BINDING SITE FOR RESIDUE CL A 302 source : AC2 5) chain A residue 220 type sequence L description BINDING SITE FOR RESIDUE CL A 302 source : AC2 6) chain A residue 235 type sequence S description BINDING SITE FOR RESIDUE CL A 302 source : AC2 7) chain A residue 61 type sequence R description BINDING SITE FOR RESIDUE CL A 303 source : AC3 8) chain A residue 61 type sequence R description BINDING SITE FOR RESIDUE CL A 304 source : AC4 9) chain A residue 62 type sequence P description BINDING SITE FOR RESIDUE CL A 304 source : AC4 10) chain A residue 63 type sequence E description BINDING SITE FOR RESIDUE CL A 304 source : AC4 11) chain A residue 214 type sequence D description BINDING SITE FOR RESIDUE MG A 305 source : AC5 12) chain A residue 70 type catalytic sequence S description 2 source MCSA : MCSA1 13) chain A residue 73 type catalytic sequence K description 2 source MCSA : MCSA1 14) chain A residue 130 type catalytic sequence S description 2 source MCSA : MCSA1 15) chain A residue 234 type catalytic sequence K description 2 source MCSA : MCSA1 16) chain A residue 237 type catalytic sequence A description 2 source MCSA : MCSA1 17) chain A residue 70 type ACT_SITE sequence S description Acyl-ester intermediate source Swiss-Prot : SWS_FT_FI1 18) chain A residue 66-81 type prosite sequence FPLTSTFKVLLCGAVL description BETA_LACTAMASE_A Beta-lactamase class-A active site. FpLTSTfKvllCGAVL source prosite : PS00146 19) chain A residue 234 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links