eF-site ID 4qy1-X
PDB Code 4qy1
Chain X

click to enlarge
Title Structure of H10 from human-infecting H10N8 in complex with avian receptor
Classification VIRAL PROTEIN
Compound hemagglutinin
Source (4QY1)
Sequence X:  GLFGAIAGFLENGWEGMVDGWYGFRHQNAQGTGQAADYKS
TQAAIDQITGKLNRLVEKTNTEFESIESEFSEIEHQIGNV
INWTKDSITDIWTYQAELLVAMENQHTIDMADSEMLNLYE
RVRKQLRQNAEEDGKGCFEIYHACDDSCMESIRNNTYDHS
QYREEALLNRLNIN
Description (1)  hemagglutinin


Functional site

1) chain X
residue 398
type
ligand
sequence H
description BINDING SITE FOR MONO-SACCHARIDE NAG X 601 BOUND TO ASN X 405
source : DC3

2) chain X
residue 402
type
ligand
sequence N
description BINDING SITE FOR MONO-SACCHARIDE NAG X 601 BOUND TO ASN X 405
source : DC3

3) chain X
residue 405
type
ligand
sequence N
description BINDING SITE FOR MONO-SACCHARIDE NAG X 601 BOUND TO ASN X 405
source : DC3

4) chain X
residue 390
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_X_601

5) chain X
residue 397-398
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence EH
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_X_601

6) chain X
residue 401-402
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_X_601

7) chain X
residue 405
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_X_601

8) chain X
residue 387
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_V_601


Display surface

Download
Links