eF-site ID 4qy1-X
PDB Code 4qy1
Chain X

click to enlarge
Title Structure of H10 from human-infecting H10N8 in complex with avian receptor
Classification VIRAL PROTEIN
Compound hemagglutinin
Source (4QY1)
Sequence X:  GLFGAIAGFLENGWEGMVDGWYGFRHQNAQGTGQAADYKS
TQAAIDQITGKLNRLVEKTNTEFESIESEFSEIEHQIGNV
INWTKDSITDIWTYQAELLVAMENQHTIDMADSEMLNLYE
RVRKQLRQNAEEDGKGCFEIYHACDDSCMESIRNNTYDHS
QYREEALLNRLNIN
Description (1)  hemagglutinin

Display surface

Download
Links