eF-site ID 4qy1-R
PDB Code 4qy1
Chain R

click to enlarge
Title Structure of H10 from human-infecting H10N8 in complex with avian receptor
Classification VIRAL PROTEIN
Compound hemagglutinin
Source (4QY1)
Sequence R:  GLFGAIAGFLENGWEGMVDGWYGFRHQNAQGTGQAADYKS
TQAAIDQITGKLNRLVEKTNTEFESIESEFSEIEHQIGNV
INWTKDSITDIWTYQAELLVAMENQHTIDMADSEMLNLYE
RVRKQLRQNAEEDGKGCFEIYHACDDSCMESIRNNTYDHS
QYREEALLNRLNIN
Description (1)  hemagglutinin


Functional site

1) chain R
residue 398
type
ligand
sequence H
description BINDING SITE FOR MONO-SACCHARIDE NAG R 601 BOUND TO ASN R 405
source : CC5

2) chain R
residue 402
type
ligand
sequence N
description BINDING SITE FOR MONO-SACCHARIDE NAG R 601 BOUND TO ASN R 405
source : CC5

3) chain R
residue 405
type
ligand
sequence N
description BINDING SITE FOR MONO-SACCHARIDE NAG R 601 BOUND TO ASN R 405
source : CC5

4) chain R
residue 390
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_R_601

5) chain R
residue 398
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence H
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_R_601

6) chain R
residue 401-402
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_R_601

7) chain R
residue 405
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_R_601

8) chain R
residue 387
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4qy1_P_601


Display surface

Download
Links