eF-site ID 4qwu-H
PDB Code 4qwu
Chain H

click to enlarge
Title yCP beta5-C52F mutant in complex with bortezomib
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Proteasome subunit alpha type-2
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae;
Sequence H:  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPK
IWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL
QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD
VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ
AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQ
KSYKFPRGTTAVLKESIVNICDIQEE
Description (1)  Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Probable proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit beta type-2 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1)


Functional site

1) chain H
residue 69
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CL G 302
source : AC2

2) chain H
residue 1
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BO2 H 301
source : AC3

3) chain H
residue 20
type
ligand
sequence S
description BINDING SITE FOR RESIDUE BO2 H 301
source : AC3

4) chain H
residue 21
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BO2 H 301
source : AC3

5) chain H
residue 45
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BO2 H 301
source : AC3

6) chain H
residue 47
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BO2 H 301
source : AC3

7) chain H
residue 48
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BO2 H 301
source : AC3

8) chain H
residue 49
type
ligand
sequence A
description BINDING SITE FOR RESIDUE BO2 H 301
source : AC3

9) chain H
residue 52
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BO2 H 301
source : AC3

10) chain H
residue 114
type
ligand
sequence H
description BINDING SITE FOR RESIDUE BO2 N 201
source : AC7

11) chain H
residue 118
type
ligand
sequence S
description BINDING SITE FOR RESIDUE BO2 N 201
source : AC7

12) chain H
residue 1
type ACT_SITE
ligand
sequence T
description Nucleophile. {ECO:0000269|PubMed:9087403}.
source Swiss-Prot : SWS_FT_FI1

13) chain H
residue 4-51
type prosite
ligand
sequence VGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWC
AGAGTAAD
description Proteasome beta-type subunits signature.[LIVMACFT]-[GSA]-[LIVMF]-x-[FYLVGAC]-x(2)-[GSACFYI]-[LIVMSTACF]-[LIVMSTAC]-[LIVMFSTAC]-[GACI]-[GSTACV]-[DES]-x(15,16)-[RK]-x(12,13)-G-x(2)-[GSTA]-D.
source prosite : PS00854


Display surface

Download
Links