eF-site ID 4qv7-P
PDB Code 4qv7
Chain P

click to enlarge
Title yCP beta5-A50V mutant
Classification HYDROLASE
Compound Proteasome subunit alpha type-2
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae;
Sequence P:  GSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAS
DGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLT
ADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQG
YTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWK
AISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTT
DSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVK
TGIT
Description (1)  Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Probable proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit beta type-2 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1)


Functional site

1) chain P
residue 35-82
type prosite
ligand
sequence IGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAV
AVAGLTAD
description Proteasome beta-type subunits signature.[LIVMACFT]-[GSA]-[LIVMF]-x-[FYLVGAC]-x(2)-[GSACFYI]-[LIVMSTACF]-[LIVMSTAC]-[LIVMFSTAC]-[GACI]-[GSTACV]-[DES]-x(15,16)-[RK]-x(12,13)-G-x(2)-[GSTA]-D.
source prosite : PS00854

2) chain P
residue 5-27
type prosite
ligand
sequence YDSRTTIFSPEGRLYQVEYALES
description Proteasome alpha-type subunits signature.[FYNAGS]-x(4)-[STNLV]-x-[FYW]-S-[PDS]-x(0,1)-G-[RKHDS]-x(2)-Q-[LIVA]-[DENR]-[YH]-[GSAD]-x(2)-[GSAG].
source prosite : PS00388


Display surface

Download
Links