eF-site ID 4qtu-A PDB Code 4qtu Chain A click to enlarge Title Structure of S. cerevisiae Bud23-Trm112 complex involved in formation of m7G1575 on 18S rRNA (SAM bound form) Classification TRANSFERASE Compound Multifunctional methyltransferase subunit TRM112 Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (BUD23_YEAST) Sequence A:  MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESI EFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPS SIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYY IKNGIPNLLLPPHL Description Functional site 1) chain A residue 11 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 2) chain A residue 16 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 3) chain A residue 112 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 4) chain A residue 115 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 5) chain A residue 14 type sequence K description BINDING SITE FOR RESIDUE EDO A 202 source : AC2 6) chain A residue 134 type sequence L description BINDING SITE FOR RESIDUE EDO A 202 source : AC2 7) chain A residue 36 type sequence Q description BINDING SITE FOR RESIDUE EDO A 203 source : AC3 8) chain A residue 117 type sequence H description BINDING SITE FOR RESIDUE EDO A 204 source : AC4 9) chain A residue 118 type sequence I description BINDING SITE FOR RESIDUE EDO A 204 source : AC4 10) chain A residue 119 type sequence Y description BINDING SITE FOR RESIDUE EDO A 204 source : AC4 11) chain A residue 120 type sequence Y description BINDING SITE FOR RESIDUE EDO A 204 source : AC4 12) chain A residue 127 type sequence N description BINDING SITE FOR RESIDUE EDO A 204 source : AC4 13) chain A residue 129 type sequence L description BINDING SITE FOR RESIDUE EDO A 204 source : AC4 14) chain A residue 48 type sequence L description BINDING SITE FOR RESIDUE EDO A 205 source : AC5 15) chain A residue 52 type sequence D description BINDING SITE FOR RESIDUE EDO A 205 source : AC5 16) chain A residue 78 type sequence F description BINDING SITE FOR RESIDUE EDO A 205 source : AC5 17) chain A residue 79 type sequence P description BINDING SITE FOR RESIDUE EDO A 205 source : AC5 18) chain A residue 87 type sequence D description BINDING SITE FOR RESIDUE EDO A 206 source : AC6 19) chain A residue 86 type sequence T description BINDING SITE FOR RESIDUE EDO B 302 source : AC9 20) chain A residue 87 type sequence D description BINDING SITE FOR RESIDUE EDO B 302 source : AC9 21) chain A residue 88 type sequence D description BINDING SITE FOR RESIDUE EDO B 302 source : AC9 22) chain A residue 43 type sequence N description BINDING SITE FOR RESIDUE EDO B 308 source : BC6 23) chain A residue 18 type sequence T description BINDING SITE FOR RESIDUE EDO C 202 source : CC2 24) chain A residue 19 type sequence S description BINDING SITE FOR RESIDUE EDO C 202 source : CC2 25) chain A residue 20 type sequence N description BINDING SITE FOR RESIDUE EDO C 202 source : CC2 26) chain A residue 21 type sequence D description BINDING SITE FOR RESIDUE EDO C 202 source : CC2

Display surface Download Links