eF-site ID 4qq4-A PDB Code 4qq4 Chain A click to enlarge Title CW-type zinc finger of MORC3 in complex with the amino terminus of histone H3 Classification METAL BINDING PROTEIN Compound MORC family CW-type zinc finger protein 3 Source Homo sapiens (Human) (H33_HUMAN) Sequence A:  PDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRN CEVPEEPE Description Functional site 1) chain A residue 436 type sequence S description BINDING SITE FOR RESIDUE CL A 2003 source : AC1 2) chain A residue 446 type sequence C description BINDING SITE FOR RESIDUE CL A 2004 source : AC2 3) chain A residue 406 type sequence P description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 4) chain A residue 407 type sequence D description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 5) chain A residue 408 type sequence Q description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 6) chain A residue 409 type sequence T description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 7) chain A residue 410 type sequence W description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 8) chain A residue 411 type sequence V description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 9) chain A residue 412 type sequence Q description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 10) chain A residue 419 type sequence W description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 11) chain A residue 424 type sequence D description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 12) chain A residue 430 type sequence P description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 13) chain A residue 431 type sequence E description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 14) chain A residue 453 type sequence E description BINDING SITE FOR CHAIN C OF HISTONE H3.3 source : AC3 15) chain A residue 428 type sequence Q description BINDING SITE FOR CHAIN D OF HISTONE H3.3 source : AC4 16) chain A residue 429 type sequence L description BINDING SITE FOR CHAIN D OF HISTONE H3.3 source : AC4 17) chain A residue 430 type sequence P description BINDING SITE FOR CHAIN D OF HISTONE H3.3 source : AC4 18) chain A residue 431 type sequence E description BINDING SITE FOR CHAIN D OF HISTONE H3.3 source : AC4 19) chain A residue 435 type MOD_RES sequence C description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links