eF-site ID 4qot-A PDB Code 4qot Chain A click to enlarge Title Crystal structure of human copper chaperone bound to the platinum ion Classification CHAPERONE Compound Copper transport protein ATOX1 Source Homo sapiens (Human) (ATOX1_HUMAN) Sequence A:  PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVC IESEHSMDTLLATLKKTGKTVSYLGLE Description Functional site 1) chain A residue 12 type sequence C description BINDING SITE FOR RESIDUE PT A 101 source : AC1 2) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE PT A 101 source : AC1 3) chain A residue 3 type sequence K description BINDING SITE FOR RESIDUE SO4 A 102 source : AC2 4) chain A residue 30 type sequence K description BINDING SITE FOR RESIDUE SO4 A 102 source : AC2 5) chain A residue 31 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 102 source : AC2 6) chain A residue 41 type sequence C description BINDING SITE FOR RESIDUE SO4 A 102 source : AC2 7) chain A residue 43 type sequence E description BINDING SITE FOR RESIDUE SO4 A 102 source : AC2 8) chain A residue 21 type sequence R description BINDING SITE FOR RESIDUE SO4 A 103 source : AC3 9) chain A residue 24 type sequence N description BINDING SITE FOR RESIDUE SO4 A 103 source : AC3 10) chain A residue 60 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O08997 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 12 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00280, ECO:0000269|PubMed:31283225, ECO:0007744|PDB:5T7L source Swiss-Prot : SWS_FT_FI1 12) chain A residue 15 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00280, ECO:0000269|PubMed:31283225, ECO:0007744|PDB:5T7L source Swiss-Prot : SWS_FT_FI1 13) chain A residue 47 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 7-35 type prosite sequence SVDMTCGGCAEAVSRVLNKLGGVKYDIDL description HMA_1 Heavy-metal-associated domain. SvDMtCgGCaeaVSrvLnklggvkyd..IdL source prosite : PS01047

Display surface Download Links