eF-site ID 4qo8-A PDB Code 4qo8 Chain A click to enlarge Title Lactate Dehydrogenase A in complex with substituted 3-Hydroxy-2-mercaptocyclohex-2-enone compound 104 Classification oxidoreductase/oxidoreductase inhibitor Compound L-lactate dehydrogenase A chain Source Homo sapiens (Human) (LDHA_HUMAN) Sequence A:  ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILM KDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGK DYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFII PNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGS GCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVW SGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEV IKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLY GIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSAD TLWGIQKELQF Description Functional site 1) chain A residue 28 type sequence G description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 2) chain A residue 29 type sequence A description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 3) chain A residue 30 type sequence V description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 4) chain A residue 51 type sequence D description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 5) chain A residue 52 type sequence V description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 6) chain A residue 53 type sequence I description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 7) chain A residue 94 type sequence T description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 8) chain A residue 95 type sequence A description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 9) chain A residue 96 type sequence G description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 10) chain A residue 98 type sequence R description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 11) chain A residue 115 type sequence I description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 12) chain A residue 119 type sequence I description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 13) chain A residue 135 type sequence V description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 14) chain A residue 136 type sequence S description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 15) chain A residue 137 type sequence N description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 16) chain A residue 160 type sequence S description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 17) chain A residue 192 type sequence H description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 18) chain A residue 247 type sequence T description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 19) chain A residue 251 type sequence I description BINDING SITE FOR RESIDUE NAI A 801 source : AC1 20) chain A residue 147 type sequence W description BINDING SITE FOR RESIDUE EPE A 802 source : AC2 21) chain A residue 151 type sequence G description BINDING SITE FOR RESIDUE EPE A 802 source : AC2 22) chain A residue 152 type sequence F description BINDING SITE FOR RESIDUE EPE A 802 source : AC2 23) chain A residue 154 type sequence K description BINDING SITE FOR RESIDUE EPE A 802 source : AC2 24) chain A residue 170 type sequence R description BINDING SITE FOR RESIDUE SO4 A 803 source : AC3 25) chain A residue 185 type sequence H description BINDING SITE FOR RESIDUE SO4 A 803 source : AC3 26) chain A residue 137 type sequence N description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 27) chain A residue 165 type sequence D description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 28) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 29) chain A residue 192 type sequence H description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 30) chain A residue 193 type sequence G description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 31) chain A residue 237 type sequence A description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 32) chain A residue 238 type sequence Y description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 33) chain A residue 241 type sequence I description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 34) chain A residue 247 type sequence T description BINDING SITE FOR RESIDUE 36U A 804 source : AC4 35) chain A residue 283 type sequence K description BINDING SITE FOR RESIDUE EPE B 802 source : AC6 36) chain A residue 182 type sequence L description BINDING SITE FOR RESIDUE SO4 C 803 source : BC2 37) chain A residue 185 type sequence H description BINDING SITE FOR RESIDUE SO4 C 803 source : BC2 38) chain A residue 192 type ACT_SITE sequence H description Proton acceptor source Swiss-Prot : SWS_FT_FI1 39) chain A residue 223 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P06151 source Swiss-Prot : SWS_FT_FI10 40) chain A residue 231 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P06151 source Swiss-Prot : SWS_FT_FI10 41) chain A residue 242 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P06151 source Swiss-Prot : SWS_FT_FI10 42) chain A residue 238 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P06151 source Swiss-Prot : SWS_FT_FI11 43) chain A residue 28 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11276087 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 98 type BINDING sequence R description BINDING => ECO:0000269|PubMed:11276087 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 46) chain A residue 137 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 47) chain A residue 168 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 48) chain A residue 247 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI3 49) chain A residue 1 type MOD_RES sequence A description N-acetylalanine => ECO:0000269|Ref.10, ECO:0007744|PubMed:19413330, ECO:0007744|PubMed:22223895 source Swiss-Prot : SWS_FT_FI4 50) chain A residue 308 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P04642 source Swiss-Prot : SWS_FT_FI12 51) chain A residue 321 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P04642 source Swiss-Prot : SWS_FT_FI12 52) chain A residue 189-195 type prosite sequence LGEHGDS description L_LDH L-lactate dehydrogenase active site. LGEHGDS source prosite : PS00064 53) chain A residue 309 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI13 54) chain A residue 56 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI14 55) chain A residue 56 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI9 56) chain A residue 4 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P06151 source Swiss-Prot : SWS_FT_FI5 57) chain A residue 117 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P06151 source Swiss-Prot : SWS_FT_FI5 58) chain A residue 317 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P06151 source Swiss-Prot : SWS_FT_FI5 59) chain A residue 9 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI6 60) chain A residue 13 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI7 61) chain A residue 80 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI7 62) chain A residue 125 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI7 63) chain A residue 17 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links