eF-site ID 4qnc-B PDB Code 4qnc Chain B click to enlarge Title Crystal structure of a SemiSWEET in an occluded state Classification MEMBRANE PROTEIN Compound chemical transport protein Source Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) (B0SR19_LEPBP) Sequence B:  MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIM FFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLT EG Description Functional site 1) chain B residue 26 type sequence M description BINDING SITE FOR RESIDUE OLC A 101 source : AC1 2) chain B residue 80 type sequence T description BINDING SITE FOR RESIDUE OLC A 103 source : AC3 3) chain B residue 34 type sequence S description BINDING SITE FOR RESIDUE OLC B 101 source : AC6 4) chain B residue 35 type sequence R description BINDING SITE FOR RESIDUE OLC B 101 source : AC6 5) chain B residue 36 type sequence N description BINDING SITE FOR RESIDUE OLC B 101 source : AC6 6) chain B residue 46 type sequence V description BINDING SITE FOR RESIDUE MYS B 102 source : AC7 7) chain B residue 50 type sequence V description BINDING SITE FOR RESIDUE MYS B 102 source : AC7 8) chain B residue 5-25 type TRANSMEM sequence IGYVAAFLTTVSFLPQVLRVV description Helical; Name=1 => ECO:0000269|PubMed:25186729 source Swiss-Prot : SWS_FT_FI1 9) chain B residue 33-53 type TRANSMEM sequence ISRNMYIMFFLGVVLWFVYGI description Helical; Name=2 => ECO:0000269|PubMed:25186729 source Swiss-Prot : SWS_FT_FI2 10) chain B residue 57-77 type TRANSMEM sequence DLPIILANVVTLFFVTIILYY description Helical; Name=3 => ECO:0000269|PubMed:25186729 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links