eF-site ID 4qnc-A PDB Code 4qnc Chain A click to enlarge Title Crystal structure of a SemiSWEET in an occluded state Classification MEMBRANE PROTEIN Compound chemical transport protein Source Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) (B0SR19_LEPBP) Sequence A:  MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIM FFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLT E Description Functional site 1) chain A residue 34 type sequence S description BINDING SITE FOR RESIDUE OLC A 101 source : AC1 2) chain A residue 35 type sequence R description BINDING SITE FOR RESIDUE OLC A 101 source : AC1 3) chain A residue 36 type sequence N description BINDING SITE FOR RESIDUE OLC A 101 source : AC1 4) chain A residue 68 type sequence L description BINDING SITE FOR RESIDUE OLC A 102 source : AC2 5) chain A residue 69 type sequence F description BINDING SITE FOR RESIDUE OLC A 102 source : AC2 6) chain A residue 72 type sequence T description BINDING SITE FOR RESIDUE OLC A 102 source : AC2 7) chain A residue 73 type sequence I description BINDING SITE FOR RESIDUE OLC A 102 source : AC2 8) chain A residue 77 type sequence Y description BINDING SITE FOR RESIDUE OLC A 102 source : AC2 9) chain A residue 76 type sequence Y description BINDING SITE FOR RESIDUE OLC A 103 source : AC3 10) chain A residue 79 type sequence L description BINDING SITE FOR RESIDUE OLC A 103 source : AC3 11) chain A residue 80 type sequence T description BINDING SITE FOR RESIDUE OLC A 103 source : AC3 12) chain A residue 11 type sequence F description BINDING SITE FOR RESIDUE MYS A 104 source : AC4 13) chain A residue 50 type sequence V description BINDING SITE FOR RESIDUE MYS A 105 source : AC5 14) chain A residue 5-25 type TRANSMEM sequence IGYVAAFLTTVSFLPQVLRVV description Helical; Name=1 => ECO:0000269|PubMed:25186729 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 33-53 type TRANSMEM sequence ISRNMYIMFFLGVVLWFVYGI description Helical; Name=2 => ECO:0000269|PubMed:25186729 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 57-77 type TRANSMEM sequence DLPIILANVVTLFFVTIILYY description Helical; Name=3 => ECO:0000269|PubMed:25186729 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links