eF-site ID 4qml-A PDB Code 4qml Chain A click to enlarge Title MST3 in complex with AMP-PNP Classification Transferase/transferase inhibitor Compound Serine/threonine-protein kinase 24 Source Homo sapiens (Human) (STK24_HUMAN) Sequence A:  ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDL EEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWI IMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHS EKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRN XFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEP PHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNK EPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE Q Description Functional site 1) chain A residue 101 type sequence Y description BINDING SITE FOR RESIDUE EDO A 401 source : AC1 2) chain A residue 102 type sequence L description BINDING SITE FOR RESIDUE EDO A 401 source : AC1 3) chain A residue 103 type sequence G description BINDING SITE FOR RESIDUE EDO A 401 source : AC1 4) chain A residue 153 type sequence S description BINDING SITE FOR RESIDUE EDO A 401 source : AC1 5) chain A residue 154 type sequence E description BINDING SITE FOR RESIDUE EDO A 401 source : AC1 6) chain A residue 162 type sequence D description BINDING SITE FOR RESIDUE MG A 402 source : AC2 7) chain A residue 31 type sequence G description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 8) chain A residue 33 type sequence G description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 9) chain A residue 34 type sequence S description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 10) chain A residue 38 type sequence V description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 11) chain A residue 51 type sequence A description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 12) chain A residue 53 type sequence K description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 13) chain A residue 99 type sequence M description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 14) chain A residue 100 type sequence E description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 15) chain A residue 102 type sequence L description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 16) chain A residue 151 type sequence L description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 17) chain A residue 162 type sequence D description BINDING SITE FOR RESIDUE ANP A 403 source : AC3 18) chain A residue 156 type ACT_SITE sequence G description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 18 type MOD_RES sequence A description Phosphothreonine; by PKA => ECO:0000269|PubMed:10644707 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 190 type MOD_RES sequence V description Phosphothreonine; by autocatalysis => ECO:0000269|PubMed:17046825, ECO:0000269|PubMed:19604147, ECO:0000269|PubMed:20124694, ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 21) chain A residue 30-53 type prosite sequence IGKGSFGEVFKGIDNRTQKVVAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGKGSFGEVFkGidnrtqkv..........VAIK source prosite : PS00107 22) chain A residue 42 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 65 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 112 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 161 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 174 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links