eF-site ID 4ql3-A PDB Code 4ql3 Chain A click to enlarge Title Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas Classification HYDROLASE Compound GTPase KRas Source Homo sapiens (Human) (RASK_HUMAN) Sequence A:  GMTEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDS YRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFL CVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCD LPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTL VREIRKHKEK Description Functional site 1) chain A residue 13 type sequence G description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 2) chain A residue 14 type sequence V description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 3) chain A residue 15 type sequence G description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 4) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 5) chain A residue 17 type sequence S description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 6) chain A residue 18 type sequence A description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 7) chain A residue 28 type sequence F description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 8) chain A residue 29 type sequence V description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 9) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 10) chain A residue 116 type sequence N description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 11) chain A residue 117 type sequence K description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 12) chain A residue 119 type sequence D description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 13) chain A residue 120 type sequence L description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 14) chain A residue 145 type sequence S description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 15) chain A residue 146 type sequence A description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 16) chain A residue 147 type sequence K description BINDING SITE FOR RESIDUE GDP A 201 source : AC1 17) chain A residue 17 type sequence S description BINDING SITE FOR RESIDUE MG A 202 source : AC2 18) chain A residue 116 type BINDING sequence N description BINDING => ECO:0000269|PubMed:22431598, ECO:0000269|PubMed:22566140 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 10 type BINDING sequence G description BINDING => ECO:0000269|PubMed:22431598, ECO:0000269|PubMed:22566140 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 29 type BINDING sequence V description BINDING => ECO:0000269|PubMed:22431598, ECO:0000269|PubMed:22566140 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 59 type BINDING sequence A description BINDING => ECO:0000269|PubMed:22431598, ECO:0000269|PubMed:22566140 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine; in GTPase KRas; alternate => ECO:0000269|Ref.17 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 2 type MOD_RES sequence T description N-acetylthreonine; in GTPase KRas, N-terminally processed => ECO:0000269|Ref.17 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 104 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:22711838 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by P.sordellii toxin TcsL => ECO:0000269|PubMed:19744486 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links