eF-site ID 4qk4-AB PDB Code 4qk4 Chain A, B click to enlarge Title Crystal structure of human nuclear receptor sf-1 (nr5a1) bound to pip2 at 2.8 a resolution Classification TRANSCRIPTION FACTOR/HORMONE Compound Steroidogenic factor 1 Source Homo sapiens (Human) (PRGC1_HUMAN) Sequence A:  SGGPNVPELILQLLQLEPDEDQVRARILGSLQEPTKSRPD QPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTL LQNCWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVA TQAGSLLHSLVLRAQELVLQLLALQLDRQEFVCLKFIILF SLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHSGDKFQ QLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQ AKQT B:  PSLLKKLLLAPA Description Functional site 1) chain A residue 262 type sequence F description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 2) chain A residue 265 type sequence L description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 3) chain A residue 266 type sequence C description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 4) chain A residue 303 type sequence S description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 5) chain A residue 306 type sequence L description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 6) chain A residue 307 type sequence V description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 7) chain A residue 340 type sequence A description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 8) chain A residue 341 type sequence G description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 9) chain A residue 344 type sequence L description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 10) chain A residue 347 type sequence L description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 11) chain A residue 429 type sequence L description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 12) chain A residue 436 type sequence Y description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 13) chain A residue 439 type sequence H description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 14) chain A residue 440 type sequence K description BINDING SITE FOR RESIDUE PIK A 501 source : AC1 15) chain A residue 275 type sequence S description BINDING SITE FOR RESIDUE EDO A 502 source : AC2 16) chain A residue 309 type sequence D description BINDING SITE FOR RESIDUE EDO A 502 source : AC2 17) chain A residue 313 type sequence R description BINDING SITE FOR RESIDUE EDO A 502 source : AC2 18) chain A residue 314 type sequence Q description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 19) chain A residue 318 type sequence G description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 20) chain A residue 352 type sequence Q description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 21) chain A residue 456 type sequence L description BINDING SITE FOR RESIDUE EDO A 504 source : AC4 22) chain A residue 456 type sequence L description BINDING SITE FOR RESIDUE EDO A 504 source : AC4 23) chain A residue 357 type sequence Q description BINDING SITE FOR RESIDUE EDO A 505 source : AC5 24) chain A residue 422 type sequence C description BINDING SITE FOR RESIDUE EDO A 505 source : AC5 25) chain A residue 424 type sequence V description BINDING SITE FOR RESIDUE EDO A 506 source : AC6 26) chain A residue 425 type sequence E description BINDING SITE FOR RESIDUE EDO A 506 source : AC6 27) chain A residue 428 type sequence A description BINDING SITE FOR RESIDUE EDO A 506 source : AC6 28) chain A residue 436 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 440 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 30) chain B residue 146 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links