eF-site ID 4qjl-A
PDB Code 4qjl
Chain A

click to enlarge
Title Crystal structure of M. ulcerans phosphopantetheinyl transferase MuPPT
Classification TRANSFERASE
Compound Phosphopantetheinyl transferase, PptII
Source Mycobacterium ulcerans (strain Agy99) (A0PQD8_MYCUA)
Sequence A:  ISMLVSSVLPGTVVDDLAYAELYSDPPGLVPLPEEEPLIA
KSVAKRRNEFITVRHCARVALGDLGVPPVPILKGDKGQPC
WPDGVVGSLTHCSGYRGAVVGRSAAVRSVGIDAEPHDVLS
NGVLDAISLPEERDEIPSAMPDGLHWDRILFCAKEATYKV
WFPLTNRWLGFEDAHITFEADDSGRTGRFVSRILIDPSAL
WGPPLTTLHGRWSVERGLVLTAIVLLEH
Description (1)  Phosphopantetheinyl transferase, PptII (E.C.2.7.8.7)


Functional site

1) chain A
residue 48
type
ligand
sequence R
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

2) chain A
residue 56
type
ligand
sequence R
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

3) chain A
residue 75
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

4) chain A
residue 78
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

5) chain A
residue 79
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

6) chain A
residue 80
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

7) chain A
residue 81
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

8) chain A
residue 91
type
ligand
sequence L
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

9) chain A
residue 92
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

10) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

11) chain A
residue 114
type
ligand
sequence D
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

12) chain A
residue 116
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

13) chain A
residue 156
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

14) chain A
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

15) chain A
residue 160
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

16) chain A
residue 161
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

17) chain A
residue 164
type
ligand
sequence F
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

18) chain A
residue 171
type
ligand
sequence L
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

19) chain A
residue 172
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

20) chain A
residue 173
type
ligand
sequence F
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

21) chain A
residue 202
type
ligand
sequence L
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

22) chain A
residue 203
type
ligand
sequence W
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

23) chain A
residue 204
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA A 301
source : AC1

24) chain A
residue 114
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A 302
source : AC2

25) chain A
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MG A 302
source : AC2

26) chain A
residue 116
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG A 302
source : AC2

27) chain A
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG A 302
source : AC2

28) chain A
residue 115
type METAL
ligand
sequence A
description Magnesium; via carbonyl oxygen. {ECO:0000213|PDB:4QJL}
source Swiss-Prot : SWS_FT_FI1

29) chain A
residue 114
type METAL
ligand
sequence D
description Magnesium. {ECO:0000213|PDB:4QJL}
source Swiss-Prot : SWS_FT_FI2

30) chain A
residue 116
type METAL
ligand
sequence E
description Magnesium. {ECO:0000213|PDB:4QJL}
source Swiss-Prot : SWS_FT_FI2

31) chain A
residue 171
type BINDING
ligand
sequence L
description Coenzyme A; via carbonyl oxygen. {ECO:0000213|PDB:4QJL}.
source Swiss-Prot : SWS_FT_FI3

32) chain A
residue 48
type BINDING
ligand
sequence R
description Coenzyme A. {ECO:0000213|PDB:4QJL}.
source Swiss-Prot : SWS_FT_FI4

33) chain A
residue 56
type BINDING
ligand
sequence R
description Coenzyme A. {ECO:0000213|PDB:4QJL}.
source Swiss-Prot : SWS_FT_FI4

34) chain A
residue 114
type BINDING
ligand
sequence D
description Coenzyme A. {ECO:0000213|PDB:4QJL}.
source Swiss-Prot : SWS_FT_FI4

35) chain A
residue 48
type binding
ligand COA: COENZYME A
sequence R
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

36) chain A
residue 51-52
type binding
ligand COA: COENZYME A
sequence EF
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

37) chain A
residue 55-56
type binding
ligand COA: COENZYME A
sequence VR
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

38) chain A
residue 75
type binding
ligand COA: COENZYME A
sequence K
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

39) chain A
residue 78-81
type binding
ligand COA: COENZYME A
sequence KGQP
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

40) chain A
residue 90-93
type binding
ligand COA: COENZYME A
sequence SLTH
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

41) chain A
residue 114-116
type binding
ligand COA: COENZYME A
sequence DAE
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

42) chain A
residue 153
type binding
ligand COA: COENZYME A
sequence F
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

43) chain A
residue 155-157
type binding
ligand COA: COENZYME A
sequence AKE
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

44) chain A
residue 159-161
type binding
ligand COA: COENZYME A
sequence TYK
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

45) chain A
residue 164-165
type binding
ligand COA: COENZYME A
sequence FP
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

46) chain A
residue 170-173
type binding
ligand COA: COENZYME A
sequence WLGF
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

47) chain A
residue 175-176
type binding
ligand COA: COENZYME A
sequence DA
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

48) chain A
residue 178
type binding
ligand COA: COENZYME A
sequence I
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301

49) chain A
residue 193
type binding
ligand COA: COENZYME A
sequence S
description COENZYME A binding site
source pdb_hetatom : COA_4qjl_A_301


Display surface

Download
Links