eF-site ID 4qih-A PDB Code 4qih Chain A click to enlarge Title The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase Rv2419c complexes with VO3 Classification HYDROLASE Compound Glucosyl-3-phosphoglycerate phosphatase Source Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (GPGP_MYCTO) Sequence A:  ARRLVMLRHGQTDYNVGSRMQGQLDTELSELGRTQAVAAA EVLGKRQPLLIVSSDLRRAYDTAVKLGERTGLVVRVDTRL RETHLGDWQGLTHAQIDADAPGARLAWREDATWAPHGGES RVDVAARSRPLVAELVASEPEWGGADEPDRPVVLVAHGGL IAALSAALLKLPVANWPALGGMGNASWTQLSGHWDFESIR WRLDVWNAS Description Functional site 1) chain A residue 10 type sequence R description BINDING SITE FOR RESIDUE VN3 A 601 source : AC1 2) chain A residue 11 type sequence H description BINDING SITE FOR RESIDUE VN3 A 601 source : AC1 3) chain A residue 17 type sequence N description BINDING SITE FOR RESIDUE VN3 A 601 source : AC1 4) chain A residue 23 type sequence Q description BINDING SITE FOR RESIDUE VN3 A 601 source : AC1 5) chain A residue 60 type sequence R description BINDING SITE FOR RESIDUE VN3 A 601 source : AC1 6) chain A residue 84 type sequence E description BINDING SITE FOR RESIDUE VN3 A 601 source : AC1 7) chain A residue 159 type sequence H description BINDING SITE FOR RESIDUE VN3 A 601 source : AC1 8) chain A residue 160 type sequence G description BINDING SITE FOR RESIDUE VN3 A 601 source : AC1 9) chain A residue 84 type ACT_SITE sequence E description Proton donor/acceptor => ECO:0000250|UniProtKB:P9WIC7 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 8-17 type prosite sequence MLRHGQTDYN description PG_MUTASE Phosphoglycerate mutase family phosphohistidine signature. MlRHGQtDyN source prosite : PS00175 11) chain A residue 11 type ACT_SITE sequence H description Tele-phosphohistidine intermediate => ECO:0000250|UniProtKB:P9WIC7 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 10 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P9WIC7 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 60 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P9WIC7 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 159 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P9WIC7 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links