eF-site ID 4qeo-ACDP PDB Code 4qeo Chain A, C, D, P click to enlarge Title crystal structure of KRYPTONITE in complex with mCHH DNA, H3(1-15) peptide and SAH Classification transcription/DNA Compound Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 Source null (4QEO) Sequence A:  LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKA KAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNG IDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVT YTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRV TRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKY RLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDD SPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSK KCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGP KCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVC EYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINH SCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYD YGYALDSVHGPDGKVKQLACYCGALNCRKRLY C:  GGTACTXATCA D:  TGATGAGTACCAT P:  KSTGGKA Description Functional site 1) chain A residue 456 type sequence K description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 2) chain A residue 457 type sequence G description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 3) chain A residue 458 type sequence W description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 4) chain A residue 492 type sequence E description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 5) chain A residue 493 type sequence Y description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 6) chain A residue 548 type sequence R description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 7) chain A residue 551 type sequence N description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 8) chain A residue 552 type sequence H description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 9) chain A residue 593 type sequence Y description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 10) chain A residue 611 type sequence A description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 11) chain A residue 612 type sequence C description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 12) chain A residue 613 type sequence Y description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 13) chain A residue 614 type sequence C description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 14) chain P residue 9 type sequence K description BINDING SITE FOR RESIDUE SAH A 801 source : AC1 15) chain A residue 383 type sequence C description BINDING SITE FOR RESIDUE ZN A 802 source : AC2 16) chain A residue 397 type sequence C description BINDING SITE FOR RESIDUE ZN A 802 source : AC2 17) chain A residue 425 type sequence C description BINDING SITE FOR RESIDUE ZN A 802 source : AC2 18) chain A residue 429 type sequence C description BINDING SITE FOR RESIDUE ZN A 802 source : AC2 19) chain A residue 389 type sequence C description BINDING SITE FOR RESIDUE ZN A 803 source : AC3 20) chain A residue 425 type sequence C description BINDING SITE FOR RESIDUE ZN A 803 source : AC3 21) chain A residue 431 type sequence C description BINDING SITE FOR RESIDUE ZN A 803 source : AC3 22) chain A residue 435 type sequence C description BINDING SITE FOR RESIDUE ZN A 803 source : AC3 23) chain A residue 383 type sequence C description BINDING SITE FOR RESIDUE ZN A 804 source : AC4 24) chain A residue 385 type sequence C description BINDING SITE FOR RESIDUE ZN A 804 source : AC4 25) chain A residue 389 type sequence C description BINDING SITE FOR RESIDUE ZN A 804 source : AC4 26) chain A residue 395 type sequence C description BINDING SITE FOR RESIDUE ZN A 804 source : AC4 27) chain A residue 554 type sequence C description BINDING SITE FOR RESIDUE ZN A 805 source : AC5 28) chain A residue 612 type sequence C description BINDING SITE FOR RESIDUE ZN A 805 source : AC5 29) chain A residue 614 type sequence C description BINDING SITE FOR RESIDUE ZN A 805 source : AC5 30) chain A residue 619 type sequence C description BINDING SITE FOR RESIDUE ZN A 805 source : AC5 31) chain A residue 418 type sequence S description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 32) chain A residue 419 type sequence R description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 33) chain A residue 420 type sequence D description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 34) chain A residue 475 type sequence Y description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 35) chain A residue 492 type sequence E description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 36) chain A residue 494 type sequence I description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 37) chain A residue 495 type sequence F description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 38) chain A residue 496 type sequence E description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 39) chain A residue 591 type sequence Y description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 40) chain A residue 593 type sequence Y description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 41) chain A residue 594 type sequence G description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 42) chain A residue 595 type sequence Y description BINDING SITE FOR CHAIN P OF HISTONE H3 source : AC6 43) chain P residue 14 type MOD_RES sequence K description N6-lactoyllysine; alternate => ECO:0000250|UniProtKB:P84228 source Swiss-Prot : SWS_FT_FI9 44) chain A residue 456 type MOD_RES sequence K description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 45) chain A residue 551 type MOD_RES sequence N description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 46) chain A residue 554 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 47) chain A residue 612 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 614 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 49) chain A residue 619 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 50) chain A residue 395 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 51) chain A residue 397 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 52) chain A residue 425 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 53) chain A residue 429 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 54) chain A residue 431 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 55) chain A residue 435 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 56) chain A residue 385 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 57) chain A residue 389 type MOD_RES sequence C description Citrulline; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI1 58) chain A residue 548 type MOD_RES sequence R description Phosphothreonine; by HASPIN => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI2 59) chain P residue 11 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI5 60) chain A residue 409-421 type prosite sequence DLNDGRLIESRDV description EF_HAND_1 EF-hand calcium-binding domain. DLNDGRLIEsrDV source prosite : PS00018 61) chain P residue 9 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000305|PubMed:12138181 source Swiss-Prot : SWS_FT_FI7 62) chain P residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links