eF-site ID 4qen-A
PDB Code 4qen
Chain A

click to enlarge
Title crystal structure of KRYPTONITE in complex with mCHH DNA and SAH
Classification transcription/DNA
Compound Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4
Source Arabidopsis thaliana (Mouse-ear cress) (4QEN)
Sequence A:  LEPHLKVTKCLRLFNKQYLLCVQAKLSRPDLKGVTEMIKA
KAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNG
IDYMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVT
YTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRV
TRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKY
RLKRLEGQPELTTDIEGLVCEDISGGLEFKGIPATNRVDD
SPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSK
KCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGP
KCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVC
EYIGVVRRTADVNEYIFEIDCPEFCIDAGSTGNFARFINH
SCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYD
YGYALDSVHGPDGKVKQLACYCGALNCRKRLY
Description (1)  Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 (E.C.2.1.1.43)/dna


Functional site

1) chain A
residue 456
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

2) chain A
residue 457
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

3) chain A
residue 458
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

4) chain A
residue 492
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

5) chain A
residue 493
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

6) chain A
residue 548
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

7) chain A
residue 551
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

8) chain A
residue 552
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

9) chain A
residue 593
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

10) chain A
residue 611
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

11) chain A
residue 612
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

12) chain A
residue 613
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

13) chain A
residue 623
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SAH A 801
source : AC1

14) chain A
residue 383
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 802
source : AC2

15) chain A
residue 397
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 802
source : AC2

16) chain A
residue 425
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 802
source : AC2

17) chain A
residue 429
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 802
source : AC2

18) chain A
residue 389
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 803
source : AC3

19) chain A
residue 425
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 803
source : AC3

20) chain A
residue 431
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 803
source : AC3

21) chain A
residue 435
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 803
source : AC3

22) chain A
residue 383
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 804
source : AC4

23) chain A
residue 385
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 804
source : AC4

24) chain A
residue 389
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 804
source : AC4

25) chain A
residue 395
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 804
source : AC4

26) chain A
residue 554
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 805
source : AC5

27) chain A
residue 612
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 805
source : AC5

28) chain A
residue 614
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 805
source : AC5

29) chain A
residue 619
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 805
source : AC5

30) chain A
residue 292
type METAL
ligand
sequence G
description Zinc 2 (By similarity)
source Swiss-Prot : SWS_FT_FI1

31) chain A
residue 306
type METAL
ligand
sequence Q
description Zinc 2 (By similarity)
source Swiss-Prot : SWS_FT_FI1

32) chain A
residue 334
type METAL
ligand
sequence E
description Zinc 2 (By similarity)
source Swiss-Prot : SWS_FT_FI1

33) chain A
residue 338
type METAL
ligand
sequence G
description Zinc 2 (By similarity)
source Swiss-Prot : SWS_FT_FI1

34) chain A
residue 292
type METAL
ligand
sequence G
description Zinc 1 (By similarity)
source Swiss-Prot : SWS_FT_FI2

35) chain A
residue 294
type METAL
ligand
sequence T
description Zinc 1 (By similarity)
source Swiss-Prot : SWS_FT_FI2

36) chain A
residue 298
type METAL
ligand
sequence Y
description Zinc 1 (By similarity)
source Swiss-Prot : SWS_FT_FI2

37) chain A
residue 304
type METAL
ligand
sequence E
description Zinc 1 (By similarity)
source Swiss-Prot : SWS_FT_FI2

38) chain A
residue 463
type METAL
ligand
sequence W
description Zinc 4 (By similarity)
source Swiss-Prot : SWS_FT_FI3

39) chain A
residue 298
type METAL
ligand
sequence Y
description Zinc 3 (By similarity)
source Swiss-Prot : SWS_FT_FI4

40) chain A
residue 334
type METAL
ligand
sequence E
description Zinc 3 (By similarity)
source Swiss-Prot : SWS_FT_FI4

41) chain A
residue 340
type METAL
ligand
sequence L
description Zinc 3 (By similarity)
source Swiss-Prot : SWS_FT_FI4

42) chain A
residue 344
type METAL
ligand
sequence G
description Zinc 3 (By similarity)
source Swiss-Prot : SWS_FT_FI4

43) chain A
residue 402
type BINDING
ligand
sequence G
description S-adenosyl-L-methionine (By similarity).
source Swiss-Prot : SWS_FT_FI5

44) chain A
residue 457
type BINDING
ligand
sequence G
description S-adenosyl-L-methionine (By similarity).
source Swiss-Prot : SWS_FT_FI5

45) chain A
residue 452
type binding
ligand SAH: S-ADENOSYL-L-HOMOCYSTEINE
sequence R
description S-ADENOSYL-L-HOMOCYSTEINE binding site
source pdb_hetatom : SAH_4qen_A_801

46) chain A
residue 455-458
type binding
ligand SAH: S-ADENOSYL-L-HOMOCYSTEINE
sequence KKGW
description S-ADENOSYL-L-HOMOCYSTEINE binding site
source pdb_hetatom : SAH_4qen_A_801

47) chain A
residue 492-493
type binding
ligand SAH: S-ADENOSYL-L-HOMOCYSTEINE
sequence EY
description S-ADENOSYL-L-HOMOCYSTEINE binding site
source pdb_hetatom : SAH_4qen_A_801

48) chain A
residue 548-553
type binding
ligand SAH: S-ADENOSYL-L-HOMOCYSTEINE
sequence RFINHS
description S-ADENOSYL-L-HOMOCYSTEINE binding site
source pdb_hetatom : SAH_4qen_A_801

49) chain A
residue 593
type binding
ligand SAH: S-ADENOSYL-L-HOMOCYSTEINE
sequence Y
description S-ADENOSYL-L-HOMOCYSTEINE binding site
source pdb_hetatom : SAH_4qen_A_801

50) chain A
residue 610-614
type binding
ligand SAH: S-ADENOSYL-L-HOMOCYSTEINE
sequence LACYC
description S-ADENOSYL-L-HOMOCYSTEINE binding site
source pdb_hetatom : SAH_4qen_A_801

51) chain A
residue 623
type binding
ligand SAH: S-ADENOSYL-L-HOMOCYSTEINE
sequence L
description S-ADENOSYL-L-HOMOCYSTEINE binding site
source pdb_hetatom : SAH_4qen_A_801


Display surface

Download
Links