eF-site ID 4q66-L PDB Code 4q66 Chain L click to enlarge Title Structure of Exomer bound to Arf1. Classification PROTEIN TRANSPORT Compound Chs5p Source Saccharomyces cerevisiae R008 (ARF1_YEAST) Sequence L:  MRILMVGLDGAGKTTVLYKLKLGTTIPTIGFNVETVFTVW DVGGLDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREV MQRMLNEDELRNAAWLVFANKEAMSAAEITEKLLHSIRPW FIQATCAGLYEGLEWLSNS Description Functional site 1) chain L residue 25 type sequence L description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 2) chain L residue 26 type sequence D description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 3) chain L residue 27 type sequence G description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 4) chain L residue 28 type sequence A description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 5) chain L residue 29 type sequence G description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 6) chain L residue 30 type sequence K description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 7) chain L residue 31 type sequence T description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 8) chain L residue 32 type sequence T description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 9) chain L residue 45 type sequence T description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 10) chain L residue 46 type sequence I description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 11) chain L residue 47 type sequence P description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 12) chain L residue 48 type sequence T description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 13) chain L residue 70 type sequence G description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 14) chain L residue 126 type sequence N description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 15) chain L residue 127 type sequence K description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 16) chain L residue 159 type sequence C description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 17) chain L residue 160 type sequence A description BINDING SITE FOR RESIDUE GNP L 201 source : AC3 18) chain L residue 31 type sequence T description BINDING SITE FOR RESIDUE MG L 202 source : AC4 19) chain L residue 48 type sequence T description BINDING SITE FOR RESIDUE MG L 202 source : AC4 20) chain L residue 160 type BINDING sequence A description BINDING => ECO:0000269|PubMed:20601958 source Swiss-Prot : SWS_FT_FI1 21) chain L residue 25 type BINDING sequence L description BINDING => ECO:0000269|PubMed:20601958 source Swiss-Prot : SWS_FT_FI1 22) chain L residue 48 type BINDING sequence T description BINDING => ECO:0000269|PubMed:20601958 source Swiss-Prot : SWS_FT_FI1 23) chain L residue 70 type BINDING sequence G description BINDING => ECO:0000269|PubMed:20601958 source Swiss-Prot : SWS_FT_FI1 24) chain L residue 126 type BINDING sequence N description BINDING => ECO:0000269|PubMed:20601958 source Swiss-Prot : SWS_FT_FI1 25) chain L residue 127 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links