eF-site ID 4q5m-A PDB Code 4q5m Chain A click to enlarge Title D30N tethered HIV-1 protease dimer/saquinavir complex Classification HYDROLASE/HYDROLASE INHIBITOR Compound Protease Source Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) (POL_HV1H2) Sequence A:  PQVTLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMSLPG RWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGMTLNFPQVTLWQRPLVTIKIGGQLKE ALLDTGADNTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQ ILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF Description Functional site 1) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 2) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 3) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 4) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 5) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 6) chain A residue 30 type sequence N description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 7) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 8) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 9) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 10) chain A residue 80 type sequence T description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 11) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 12) chain A residue 82 type sequence V description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 13) chain A residue 84 type sequence I description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 14) chain A residue 1008 type sequence R description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 15) chain A residue 1025 type sequence D description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 16) chain A residue 1027 type sequence G description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 17) chain A residue 1028 type sequence A description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 18) chain A residue 1029 type sequence D description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 19) chain A residue 1030 type sequence N description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 20) chain A residue 1048 type sequence G description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 21) chain A residue 1049 type sequence G description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 22) chain A residue 1050 type sequence I description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 23) chain A residue 1081 type sequence P description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 24) chain A residue 1082 type sequence V description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 25) chain A residue 1084 type sequence I description BINDING SITE FOR RESIDUE ROC A 1101 source : AC1 26) chain A residue 1025 type ACT_SITE sequence D description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094, ECO:0000305|PubMed:33542150 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 1099 type SITE sequence F description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 22-33 type prosite sequence ALLDTGADNTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADNTVL source prosite : PS00141 29) chain A residue 1022-1033 type prosite sequence ALLDTGADNTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADNTVL source prosite : PS00141 30) chain A residue 1025 type catalytic sequence D description 175 source MCSA : MCSA1 31) chain A residue 1026 type catalytic sequence T description 175 source MCSA : MCSA1 32) chain A residue 1027 type catalytic sequence G description 175 source MCSA : MCSA1

Display surface Download Links