eF-site ID 4q5e-B PDB Code 4q5e Chain B click to enlarge Title Shigella Effector Kinase OspG bound to E2-Ub UbcH7-Ub Conjugate Classification UNKNOWN FUNCTION, PROTEIN BINDING Compound Protein kinase OspG Source Shigella sonnei (strain Ss046) (UB2L3_HUMAN) Sequence B:  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQ QRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRLRGC Description (1)  Protein kinase OspG (E.C.2.7.-.-), Polyubiquitin (E.C.6.3.2.19), Ubiquitin-conjugating enzyme E2 L3 (E.C.6.3.2.19) Functional site 1) chain B residue 11 type ACT_SITE sequence K description Glycyl thioester intermediate => ECO:0000255|PROSITE-ProRule:PRU00388, ECO:0000255|PROSITE-ProRule:PRU10133 source Swiss-Prot : SWS_FT_FI1 2) chain B residue 27 type ACT_SITE sequence K description Glycyl thioester intermediate => ECO:0000255|PROSITE-ProRule:PRU00388, ECO:0000255|PROSITE-ProRule:PRU10133 source Swiss-Prot : SWS_FT_FI1 3) chain B residue 29 type ACT_SITE sequence K description Glycyl thioester intermediate => ECO:0000255|PROSITE-ProRule:PRU00388, ECO:0000255|PROSITE-ProRule:PRU10133 source Swiss-Prot : SWS_FT_FI1 4) chain B residue 33 type ACT_SITE sequence K description Glycyl thioester intermediate => ECO:0000255|PROSITE-ProRule:PRU00388, ECO:0000255|PROSITE-ProRule:PRU10133 source Swiss-Prot : SWS_FT_FI1 5) chain B residue 63 type ACT_SITE sequence K description Glycyl thioester intermediate => ECO:0000255|PROSITE-ProRule:PRU00388, ECO:0000255|PROSITE-ProRule:PRU10133 source Swiss-Prot : SWS_FT_FI1 6) chain B residue 76 type MOD_RES sequence C description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI2 7) chain B residue 27-52 type prosite sequence KSKIQDKEGIPPDQQRLIFAGRQLED description UBIQUITIN_1 Ubiquitin domain signature. KskIqDkegIPpdqQrLIFaGrqleD source prosite : PS00299 8) chain B residue 48 type CROSSLNK sequence R description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:7862120 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links