eF-site ID 4q46-A PDB Code 4q46 Chain A click to enlarge Title The second structure of Influenza B PB2 cap-binding domain complex with GDP Classification VIRAL PROTEIN Compound Polymerase basic protein 2 Source (4Q46) Sequence A:  IRQRQRFGRLELKRISGRGFKNDEEILIGNGTIQKIGIWD GEEEFHVRCGECRGILKKSKMKLEKLLINSAKKEDMRDLI ILCMVFSQDTRMFQGVRGEINFLNRAGQLLSPMYQLQRYF LNRSSDLFDQWGYEESPKASELHGINESMNASDYTLKGVV VTKN Description Functional site 1) chain A residue 327 type sequence F description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 2) chain A residue 334 type sequence R description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 3) chain A residue 341 type sequence K description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 4) chain A residue 359 type sequence W description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 5) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 6) chain A residue 378 type sequence K description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 7) chain A residue 406 type sequence F description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 8) chain A residue 431 type sequence S description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 9) chain A residue 433 type sequence M description BINDING SITE FOR RESIDUE GDP A 501 source : AC1 10) chain A residue 326 type sequence R description BINDING SITE FOR RESIDUE GDP B 501 source : AC2 11) chain A residue 368 type sequence R description BINDING SITE FOR RESIDUE GDP B 501 source : AC2 12) chain A residue 370 type sequence G description BINDING SITE FOR RESIDUE GDP B 501 source : AC2

Display surface Download Links