eF-site ID 4pzt-A PDB Code 4pzt Chain A click to enlarge Title Crystal structure of p300 histone acetyltransferase domain in complex with an inhibitor, Acetonyl-Coenzyme A Classification TRANSFERASE/TRANSFERASE INHIBITOR Compound Histone acetyltransferase p300 Source Homo sapiens (Human) (EP300_HUMAN) Sequence A:  KFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVV HASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEI DGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRP KCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDY IFHCHPPDQKIPKPKRLQEWFKKMLDKAVSERIVHDYKDI FKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEE RKREENTSDLSQKLYATMEKHKEVFFVIRLIAGPAANSLP PIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWS TMCMLVELHTQSQD Description Functional site 1) chain A residue 1397 type sequence Y description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 2) chain A residue 1398 type sequence L description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 3) chain A residue 1399 type sequence D description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 4) chain A residue 1400 type sequence S description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 5) chain A residue 1410 type sequence R description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 6) chain A residue 1411 type sequence T description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 7) chain A residue 1414 type sequence Y description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 8) chain A residue 1436 type sequence W description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 9) chain A residue 1440 type sequence P description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 10) chain A residue 1446 type sequence Y description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 11) chain A residue 1456 type sequence K description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 12) chain A residue 1457 type sequence I description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 13) chain A residue 1458 type sequence P description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 14) chain A residue 1462 type sequence R description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 15) chain A residue 1463 type sequence L description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 16) chain A residue 1466 type sequence W description BINDING SITE FOR RESIDUE SOP A 1701 source : AC1 17) chain A residue 1434 type sequence H description BINDING SITE FOR RESIDUE DMS A 1702 source : AC2 18) chain A residue 1486 type sequence I description BINDING SITE FOR RESIDUE DMS A 1702 source : AC2 19) chain A residue 1507 type sequence D description BINDING SITE FOR RESIDUE DMS A 1702 source : AC2 20) chain A residue 1595 type sequence F description BINDING SITE FOR RESIDUE DMS A 1702 source : AC2 21) chain A residue 1596 type sequence F description BINDING SITE FOR RESIDUE DMS A 1702 source : AC2 22) chain A residue 1436 type sequence W description BINDING SITE FOR RESIDUE DMS A 1703 source : AC3 23) chain A residue 1591 type sequence H description BINDING SITE FOR RESIDUE DMS A 1703 source : AC3 24) chain A residue 1594 type sequence V description BINDING SITE FOR RESIDUE DMS A 1703 source : AC3 25) chain A residue 1468 type sequence K description BINDING SITE FOR RESIDUE DMS A 1704 source : AC4 26) chain A residue 1485 type sequence D description BINDING SITE FOR RESIDUE DMS A 1704 source : AC4 27) chain A residue 1593 type sequence E description BINDING SITE FOR RESIDUE DMS A 1704 source : AC4 28) chain A residue 1595 type sequence F description BINDING SITE FOR RESIDUE DMS A 1704 source : AC4 29) chain A residue 1596 type sequence F description BINDING SITE FOR RESIDUE DMS A 1704 source : AC4 30) chain A residue 1410 type BINDING sequence R description BINDING => ECO:0000269|PubMed:24819397 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 1457 type BINDING sequence I description BINDING => ECO:0000269|PubMed:24819397 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 1462 type BINDING sequence R description BINDING => ECO:0000269|PubMed:24819397 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 1466 type BINDING sequence W description BINDING => ECO:0000269|PubMed:24819397 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 1398 type BINDING sequence L description BINDING => ECO:0000269|PubMed:24819397 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 1336 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17065153 source Swiss-Prot : SWS_FT_FI2 36) chain A residue 1473 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17065153 source Swiss-Prot : SWS_FT_FI2 37) chain A residue 1499 type MOD_RES sequence K description N6-acetyllysine; by autocatalysis => ECO:0000269|PubMed:15004546 source Swiss-Prot : SWS_FT_FI3 38) chain A residue 1583 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links