eF-site ID 4pzg-A PDB Code 4pzg Chain A click to enlarge Title Crystal structure of human sorting nexin 10 (SNX10) Classification PROTEIN TRANSPORT Compound Sorting nexin-10 Source Homo sapiens (Human) (SNX10_HUMAN) Sequence A:  EEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKT SCVRRRYREFVWLRQRLQSNALLVQLPELPSKNLFFNMNN RQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLFLQSHLNS EDIEACVSGQTKYSVEEAIHKFALMNRRFPEE Description (1)  Sorting nexin-10 Functional site 1) chain A residue 45 type sequence M description BINDING SITE FOR RESIDUE NO3 A 301 source : AC1 2) chain A residue 46 type sequence K description BINDING SITE FOR RESIDUE NO3 A 301 source : AC1 3) chain A residue 47 type sequence T description BINDING SITE FOR RESIDUE NO3 A 301 source : AC1 4) chain A residue 154 type sequence R description BINDING SITE FOR RESIDUE NO3 A 301 source : AC1 5) chain A residue 84 type sequence N description BINDING SITE FOR RESIDUE NO3 A 302 source : AC2 6) chain A residue 84 type sequence N description BINDING SITE FOR RESIDUE NO3 A 302 source : AC2 7) chain A residue 87 type sequence N description BINDING SITE FOR RESIDUE NO3 A 302 source : AC2 8) chain A residue 87 type sequence N description BINDING SITE FOR RESIDUE NO3 A 302 source : AC2 9) chain A residue 90 type sequence H description BINDING SITE FOR RESIDUE NO3 A 302 source : AC2 10) chain A residue 90 type sequence H description BINDING SITE FOR RESIDUE NO3 A 302 source : AC2 11) chain A residue 30 type sequence I description BINDING SITE FOR RESIDUE NO3 A 303 source : AC3 12) chain A residue 53 type sequence R description BINDING SITE FOR RESIDUE NO3 A 303 source : AC3 13) chain A residue 54 type sequence Y description BINDING SITE FOR RESIDUE NO3 A 303 source : AC3 14) chain A residue 55 type sequence R description BINDING SITE FOR RESIDUE NO3 A 303 source : AC3 15) chain A residue 80 type sequence N description BINDING SITE FOR RESIDUE NO3 A 303 source : AC3 16) chain A residue 28 type sequence S description BINDING SITE FOR RESIDUE NO3 A 304 source : AC4 17) chain A residue 79 type sequence K description BINDING SITE FOR RESIDUE NO3 A 304 source : AC4 18) chain A residue 80 type sequence N description BINDING SITE FOR RESIDUE NO3 A 304 source : AC4 19) chain A residue 81 type sequence L description BINDING SITE FOR RESIDUE NO3 A 304 source : AC4 20) chain A residue 61 type sequence R description BINDING SITE FOR RESIDUE NO3 A 305 source : AC5 21) chain A residue 61 type sequence R description BINDING SITE FOR RESIDUE NO3 A 305 source : AC5 22) chain A residue 65 type sequence Q description BINDING SITE FOR RESIDUE NO3 A 305 source : AC5 23) chain A residue 65 type sequence Q description BINDING SITE FOR RESIDUE NO3 A 305 source : AC5 24) chain A residue 47 type sequence T description BINDING SITE FOR RESIDUE PE5 A 306 source : AC6 25) chain A residue 48 type sequence S description BINDING SITE FOR RESIDUE PE5 A 306 source : AC6 26) chain A residue 49 type sequence C description BINDING SITE FOR RESIDUE PE5 A 306 source : AC6 27) chain A residue 153 type sequence N description BINDING SITE FOR RESIDUE PE5 A 306 source : AC6 28) chain A residue 154 type sequence R description BINDING SITE FOR RESIDUE PE5 A 306 source : AC6 29) chain A residue 27 type sequence H description BINDING SITE FOR RESIDUE PE5 A 307 source : AC7 30) chain A residue 55 type sequence R description BINDING SITE FOR RESIDUE PE5 A 307 source : AC7 31) chain A residue 59 type sequence W description BINDING SITE FOR RESIDUE PE5 A 307 source : AC7 32) chain A residue 28 type sequence S description BINDING SITE FOR RESIDUE PE5 A 308 source : AC8 33) chain A residue 28 type sequence S description BINDING SITE FOR RESIDUE PE5 A 308 source : AC8 34) chain A residue 80 type sequence N description BINDING SITE FOR RESIDUE PE5 A 308 source : AC8 35) chain A residue 80 type sequence N description BINDING SITE FOR RESIDUE PE5 A 308 source : AC8 36) chain A residue 81 type sequence L description BINDING SITE FOR RESIDUE PE5 A 308 source : AC8 37) chain A residue 81 type sequence L description BINDING SITE FOR RESIDUE PE5 A 308 source : AC8 38) chain A residue 83 type sequence F description BINDING SITE FOR RESIDUE PE5 A 308 source : AC8 39) chain A residue 83 type sequence F description BINDING SITE FOR RESIDUE PE5 A 308 source : AC8 40) chain A residue 75 type sequence E description BINDING SITE FOR RESIDUE PE5 A 309 source : AC9 41) chain A residue 76 type sequence L description BINDING SITE FOR RESIDUE PE5 A 309 source : AC9 42) chain A residue 78 type sequence S description BINDING SITE FOR RESIDUE PE5 A 309 source : AC9 43) chain A residue 26 type sequence W description BINDING SITE FOR RESIDUE PE5 A 310 source : BC1 44) chain A residue 61 type sequence R description BINDING SITE FOR RESIDUE PE5 A 310 source : BC1 45) chain A residue 76 type sequence L description BINDING SITE FOR RESIDUE PE5 A 310 source : BC1 46) chain A residue 39 type sequence N description BINDING SITE FOR RESIDUE PE5 B 308 source : BC9 47) chain A residue 53 type BINDING sequence R description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 79 type BINDING sequence K description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 49) chain A residue 94 type BINDING sequence R description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links