eF-site ID 4puf-D PDB Code 4puf Chain D click to enlarge Title Complex between the Salmonella T3SS effector SlrP and its human target thioredoxin-1 Classification LIGASE/OXIDOREDUCTASE Compound E3 ubiquitin-protein ligase SlrP Source null (THIO_HUMAN) Sequence D:  HHHHHGSMVKQIESKTAFQEALDAAGDKLVVVDFSATWCG PCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKC MPTFQFFKKGQKVGEFSGANKEKLEATINELV Description Functional site 1) chain D residue 32 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:9108029 source Swiss-Prot : SWS_FT_FI1 2) chain D residue 35 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:9108029 source Swiss-Prot : SWS_FT_FI1 3) chain D residue 26 type SITE sequence D description Deprotonates C-terminal active site Cys => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 4) chain D residue 33 type SITE sequence G description Contributes to redox potential value => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 5) chain D residue 34 type SITE sequence P description Contributes to redox potential value => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 6) chain D residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 7) chain D residue 39 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 8) chain D residue 8 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P10639 source Swiss-Prot : SWS_FT_FI5 9) chain D residue 62 type MOD_RES sequence C description S-nitrosocysteine => ECO:0000269|PubMed:17260951 source Swiss-Prot : SWS_FT_FI6 10) chain D residue 69 type MOD_RES sequence C description S-nitrosocysteine => ECO:0000269|PubMed:17260951 source Swiss-Prot : SWS_FT_FI6 11) chain D residue 73 type MOD_RES sequence C description S-nitrosocysteine; alternate => ECO:0000269|PubMed:16408020, ECO:0000269|PubMed:17606900 source Swiss-Prot : SWS_FT_FI7 12) chain D residue 94 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P10639 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links