eF-site ID 4pqt-A PDB Code 4pqt Chain A click to enlarge Title Insights into the mechanism of deubiquitination by JAMM deubiquitinases from co-crystal structures of enzyme with substrate and product Classification Hydrolase/transcription Compound AMSH-like protease sst2 Source Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (J3QRK5_HUMAN) Sequence A:  KIHAYTEGGKPLRTIYLPKLLKKVFLDVVKPNTKKNLETC GILCGKLRQNAFFITHLVIPLQEATSDTCGTTDEASLFEF QDKHNLLTLGWIHTHPTQTCFMSSVALHTHCSYQLMLPEA IAIVMAPSKNTSGIFRLLDPEGLQTIVKCRKPGLFHPHEG KVYTMVAQPGHVREINSKLQVVDLR Description Functional site 1) chain A residue 356 type sequence H description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 2) chain A residue 397 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 3) chain A residue 404 type sequence H description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 4) chain A residue 406 type sequence H description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 5) chain A residue 416 type sequence Q description BINDING SITE FOR RESIDUE EDO A 503 source : AC2 6) chain A residue 417 type sequence P description BINDING SITE FOR RESIDUE EDO A 503 source : AC2 7) chain A residue 418 type sequence G description BINDING SITE FOR RESIDUE EDO A 503 source : AC2 8) chain A residue 341 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU01182 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 343 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU01182 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 354 type BINDING sequence A description BINDING => ECO:0000255|PROSITE-ProRule:PRU01182 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 356 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 397 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 404 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 406 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 286 type SITE sequence E description Indirect zinc-binding => ECO:0000250 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links