eF-site ID 4pd4-I
PDB Code 4pd4
Chain I

click to enlarge
Title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Classification OXIDOREDUCTASE/INHIBITOR
Compound Cytochrome b-c1 complex subunit 1, mitochondrial
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence I:  SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYE
NHNKGKLWKDVKARIAA
Description (1)  Cytochrome b-c1 complex subunit 1, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 2, mitochondrial (E.C.1.10.2.2), CYTOCHROME B (E.C.1.10.2.2), Cytochrome c1, heme protein, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit Rieske, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 6 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 7 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 8 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 9 (E.C.1.10.2.2), HEAVY CHAIN (VH) OF FV-FRAGMENT (E.C.1.10.2.2), LIGHT CHAIN (VL) OF FV-FRAGMENT (E.C.1.10.2.2)


Functional site

1) chain I
residue 14
type
ligand
sequence N
description binding site for residue UMQ A 501
source : AC1

2) chain I
residue 15
type
ligand
sequence A
description binding site for residue UMQ A 501
source : AC1

3) chain I
residue 16
type
ligand
sequence V
description binding site for residue UMQ A 501
source : AC1

4) chain I
residue 17
type
ligand
sequence F
description binding site for residue UMQ A 501
source : AC1

5) chain I
residue 18
type
ligand
sequence V
description binding site for residue UMQ A 501
source : AC1

6) chain I
residue 15-36
type TRANSMEM
ligand
sequence AVFVGTIFAGAFVFQTVFDTAI
description Helical. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI11

7) chain I
residue 13-18
type binding
ligand UMQ: UNDECYL-MALTOSIDE
sequence RNAVFV
description UNDECYL-MALTOSIDE binding site
source pdb_hetatom : UMQ_4pd4_A_501

8) chain I
residue 21-22
type binding
ligand UMQ: UNDECYL-MALTOSIDE
sequence IF
description UNDECYL-MALTOSIDE binding site
source pdb_hetatom : UMQ_4pd4_A_501

9) chain I
residue 29
type binding
ligand 3PH: 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
sequence Q
description 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE binding site
source pdb_hetatom : 3PH_4pd4_E_302

10) chain I
residue 33
type binding
ligand 3PH: 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
sequence D
description 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE binding site
source pdb_hetatom : 3PH_4pd4_E_302


Display surface

Download
Links