eF-site ID 4pd4-I PDB Code 4pd4 Chain I click to enlarge Title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Classification OXIDOREDUCTASE/INHIBITOR Compound Cytochrome b-c1 complex subunit 1, mitochondrial Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence I:  SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYE NHNKGKLWKDVKARIAA Description Functional site 1) chain I residue 14 type sequence N description binding site for residue UMQ A 501 source : AC1 2) chain I residue 15 type sequence A description binding site for residue UMQ A 501 source : AC1 3) chain I residue 16 type sequence V description binding site for residue UMQ A 501 source : AC1 4) chain I residue 17 type sequence F description binding site for residue UMQ A 501 source : AC1 5) chain I residue 18 type sequence V description binding site for residue UMQ A 501 source : AC1 6) chain I residue 2-17 type TOPO_DOM sequence SFSSLYKTFFKRNAVF description Mitochondrial matrix => ECO:0000269|PubMed:18390544, ECO:0000269|PubMed:30598554 source Swiss-Prot : SWS_FT_FI1 7) chain I residue 18-43 type TRANSMEM sequence VGTIFAGAFVFQTVFDTAITSWYENH description Helical => ECO:0000269|PubMed:18390544, ECO:0000269|PubMed:30598554 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links