eF-site ID 4pd4-H
PDB Code 4pd4
Chain H

click to enlarge
Title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Classification OXIDOREDUCTASE/INHIBITOR
Compound Cytochrome b-c1 complex subunit 1, mitochondrial
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence H:  GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIF
HNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLY
SKAGREELERVNV
Description (1)  Cytochrome b-c1 complex subunit 1, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 2, mitochondrial (E.C.1.10.2.2), CYTOCHROME B (E.C.1.10.2.2), Cytochrome c1, heme protein, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit Rieske, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 6 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 7 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 8 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 9 (E.C.1.10.2.2), HEAVY CHAIN (VH) OF FV-FRAGMENT (E.C.1.10.2.2), LIGHT CHAIN (VL) OF FV-FRAGMENT (E.C.1.10.2.2)


Functional site

1) chain H
residue 32
type binding
ligand UMQ: UNDECYL-MALTOSIDE
sequence Y
description UNDECYL-MALTOSIDE binding site
source pdb_hetatom : UMQ_4pd4_A_501

2) chain H
residue 55
type binding
ligand 3PH: 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
sequence Q
description 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE binding site
source pdb_hetatom : 3PH_4pd4_C_4006

3) chain H
residue 59
type binding
ligand 3PH: 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
sequence V
description 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE binding site
source pdb_hetatom : 3PH_4pd4_C_4006


Display surface

Download
Links