eF-site ID 4pd4-E PDB Code 4pd4 Chain E click to enlarge Title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action Classification OXIDOREDUCTASE/INHIBITOR Compound Cytochrome b-c1 complex subunit 1, mitochondrial Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence E:  KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAG AKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVK WQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDP QWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGR IRKGPAPLNLEIPAYEFDGDKVIVG Description Functional site 1) chain E residue 57 type sequence Y description binding site for residue UMQ A 501 source : AC1 2) chain E residue 68 type sequence S description binding site for residue UMQ A 501 source : AC1 3) chain E residue 67 type sequence S description binding site for residue 3PH A 502 source : AC2 4) chain E residue 181 type sequence H description binding site for residue AOQ C 4003 source : AC5 5) chain E residue 159 type sequence C description binding site for residue FES E 301 source : AD1 6) chain E residue 161 type sequence H description binding site for residue FES E 301 source : AD1 7) chain E residue 162 type sequence L description binding site for residue FES E 301 source : AD1 8) chain E residue 178 type sequence C description binding site for residue FES E 301 source : AD1 9) chain E residue 180 type sequence C description binding site for residue FES E 301 source : AD1 10) chain E residue 181 type sequence H description binding site for residue FES E 301 source : AD1 11) chain E residue 183 type sequence S description binding site for residue FES E 301 source : AD1 12) chain E residue 70 type sequence G description binding site for residue 3PH E 302 source : AD2 13) chain E residue 71 type sequence A description binding site for residue 3PH E 302 source : AD2 14) chain E residue 73 type sequence S description binding site for residue 3PH E 302 source : AD2 15) chain E residue 74 type sequence T description binding site for residue 3PH E 302 source : AD2 16) chain E residue 77 type sequence T description binding site for residue 3PH E 302 source : AD2 17) chain E residue 178 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10873857, ECO:0000269|PubMed:11880631, ECO:0000269|PubMed:18390544, ECO:0000269|PubMed:30598554, ECO:0007744|PDB:1EZV, ECO:0007744|PDB:1KB9, ECO:0007744|PDB:1KYO, ECO:0007744|PDB:1P84, ECO:0007744|PDB:2IBZ, ECO:0007744|PDB:3CX5, ECO:0007744|PDB:3CXH, ECO:0007744|PDB:4PD4 source Swiss-Prot : SWS_FT_FI4 18) chain E residue 181 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10873857, ECO:0000269|PubMed:11880631, ECO:0000269|PubMed:18390544, ECO:0000269|PubMed:30598554, ECO:0007744|PDB:1EZV, ECO:0007744|PDB:1KB9, ECO:0007744|PDB:1KYO, ECO:0007744|PDB:1P84, ECO:0007744|PDB:2IBZ, ECO:0007744|PDB:3CX5, ECO:0007744|PDB:3CXH, ECO:0007744|PDB:4PD4 source Swiss-Prot : SWS_FT_FI4 19) chain E residue 159 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10873857, ECO:0000269|PubMed:11880631, ECO:0000269|PubMed:18390544, ECO:0000269|PubMed:30598554, ECO:0007744|PDB:1EZV, ECO:0007744|PDB:1KB9, ECO:0007744|PDB:1KYO, ECO:0007744|PDB:1P84, ECO:0007744|PDB:2IBZ, ECO:0007744|PDB:3CX5, ECO:0007744|PDB:3CXH, ECO:0007744|PDB:4PD4 source Swiss-Prot : SWS_FT_FI4 20) chain E residue 161 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10873857, ECO:0000269|PubMed:11880631, ECO:0000269|PubMed:18390544, ECO:0000269|PubMed:30598554, ECO:0007744|PDB:1EZV, ECO:0007744|PDB:1KB9, ECO:0007744|PDB:1KYO, ECO:0007744|PDB:1P84, ECO:0007744|PDB:2IBZ, ECO:0007744|PDB:3CX5, ECO:0007744|PDB:3CXH, ECO:0007744|PDB:4PD4 source Swiss-Prot : SWS_FT_FI4 21) chain E residue 181 type catalytic sequence H description 208 source MCSA : MCSA1

Display surface Download Links