eF-site ID 4pd4-A
PDB Code 4pd4
Chain A

click to enlarge
Title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Classification OXIDOREDUCTASE/INHIBITOR
Compound Cytochrome b-c1 complex subunit 1, mitochondrial
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence A:  AEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYN
NGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIV
SSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLK
QVQDFEDNDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLE
NLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESK
NLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVE
GEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNI
QEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHF
TLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVND
ANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRL
WDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW
Description (1)  Cytochrome b-c1 complex subunit 1, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 2, mitochondrial (E.C.1.10.2.2), CYTOCHROME B (E.C.1.10.2.2), Cytochrome c1, heme protein, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit Rieske, mitochondrial (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 6 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 7 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 8 (E.C.1.10.2.2), Cytochrome b-c1 complex subunit 9 (E.C.1.10.2.2), HEAVY CHAIN (VH) OF FV-FRAGMENT (E.C.1.10.2.2), LIGHT CHAIN (VL) OF FV-FRAGMENT (E.C.1.10.2.2)


Functional site

1) chain A
residue 427
type
ligand
sequence W
description binding site for residue UMQ A 501
source : AC1

2) chain A
residue 428
type
ligand
sequence D
description binding site for residue UMQ A 501
source : AC1

3) chain A
residue 453
type
ligand
sequence S
description binding site for residue UMQ A 501
source : AC1

4) chain A
residue 454
type
ligand
sequence M
description binding site for residue UMQ A 501
source : AC1

5) chain A
residue 455
type
ligand
sequence M
description binding site for residue UMQ A 501
source : AC1

6) chain A
residue 456
type
ligand
sequence R
description binding site for residue UMQ A 501
source : AC1

7) chain A
residue 450
type
ligand
sequence S
description binding site for residue 3PH A 502
source : AC2

8) chain A
residue 427-428
type binding
ligand UMQ: UNDECYL-MALTOSIDE
sequence WD
description UNDECYL-MALTOSIDE binding site
source pdb_hetatom : UMQ_4pd4_A_501

9) chain A
residue 450
type binding
ligand UMQ: UNDECYL-MALTOSIDE
sequence S
description UNDECYL-MALTOSIDE binding site
source pdb_hetatom : UMQ_4pd4_A_501

10) chain A
residue 453-456
type binding
ligand UMQ: UNDECYL-MALTOSIDE
sequence SMMR
description UNDECYL-MALTOSIDE binding site
source pdb_hetatom : UMQ_4pd4_A_501

11) chain A
residue 450
type binding
ligand 3PH: 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
sequence S
description 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE binding site
source pdb_hetatom : 3PH_4pd4_A_502

12) chain A
residue 453
type binding
ligand 3PH: 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
sequence S
description 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE binding site
source pdb_hetatom : 3PH_4pd4_A_502

13) chain A
residue 455
type binding
ligand 3PH: 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
sequence M
description 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE binding site
source pdb_hetatom : 3PH_4pd4_A_502


Display surface

Download
Links