eF-site ID 4pbu-Z PDB Code 4pbu Chain Z click to enlarge Title Serial Time-resolved crystallography of Photosystem II using a femtosecond X-ray laser The S1 state Classification PHOTOSYNTHESIS Compound Photosystem Q(B) protein 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus; Sequence Z:  MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLI FLGSGLWIALVLVVGVLNFFVV Description Functional site 1) chain Z residue 20 type sequence V description binding site for residue CLA C 511 source : AH3 2) chain Z residue 23 type sequence V description binding site for residue CLA C 511 source : AH3 3) chain Z residue 28 type sequence A description binding site for residue CLA C 511 source : AH3 4) chain Z residue 51 type sequence V description binding site for residue BCR C 514 source : AH6 5) chain Z residue 55 type sequence G description binding site for residue BCR C 514 source : AH6 6) chain Z residue 16 type sequence S description binding site for residue BCR K 101 source : AJ7 7) chain Z residue 17 type sequence F description binding site for residue BCR Y 101 source : AK4 8) chain Z residue 1 type MOD_RES sequence M description N-formylmethionine => ECO:0000269|PubMed:19219048, ECO:0000269|PubMed:20558739 source Swiss-Prot : SWS_FT_FI5 9) chain Z residue 5-25 type TRANSMEM sequence FQLALAALVILSFVMVIGVPV description Helical => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI2 10) chain Z residue 37-58 type TRANSMEM sequence KQLIFLGSGLWIALVLVVGVLN description Helical => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI2 11) chain Z residue 26-36 type TOPO_DOM sequence AYASPQDWDRS description Cytoplasmic => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI3 12) chain Z residue 59-62 type TOPO_DOM sequence FFVV description Lumenal => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI4 13) chain Z residue 1-4 type TOPO_DOM sequence MTIL description Lumenal source Swiss-Prot : SWS_FT_FI1

Display surface Download Links