eF-site ID 4orb-A PDB Code 4orb Chain A click to enlarge Title Crystal structure of mouse calcineurin Classification HYDROLASE/METAL BINDING PROTEIN Compound Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform Source Mus musculus (Mouse) (CANB1_MOUSE) Sequence A:  TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKE GRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHG QFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYL WALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSER VYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIR KLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTV RGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRK SQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQ FNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICS SFEEAKGLDRINERMPP Description Functional site 1) chain A residue 90 type sequence D description BINDING SITE FOR RESIDUE ZN A 601 source : AC1 2) chain A residue 118 type sequence D description BINDING SITE FOR RESIDUE ZN A 601 source : AC1 3) chain A residue 150 type sequence N description BINDING SITE FOR RESIDUE ZN A 601 source : AC1 4) chain A residue 199 type sequence H description BINDING SITE FOR RESIDUE ZN A 601 source : AC1 5) chain A residue 281 type sequence H description BINDING SITE FOR RESIDUE ZN A 601 source : AC1 6) chain A residue 90 type sequence D description BINDING SITE FOR RESIDUE FE A 602 source : AC2 7) chain A residue 92 type sequence H description BINDING SITE FOR RESIDUE FE A 602 source : AC2 8) chain A residue 118 type sequence D description BINDING SITE FOR RESIDUE FE A 602 source : AC2 9) chain A residue 118 type SITE sequence D description Interaction with PxVP motif in substrates of the catalytic subunit => ECO:0000250|UniProtKB:P63098 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 150 type SITE sequence N description Interaction with PxVP motif in substrates of the catalytic subunit => ECO:0000250|UniProtKB:P63098 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 199 type SITE sequence H description Interaction with PxVP motif in substrates of the catalytic subunit => ECO:0000250|UniProtKB:P63098 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 281 type SITE sequence H description Interaction with PxVP motif in substrates of the catalytic subunit => ECO:0000250|UniProtKB:P63098 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 224 type MOD_RES sequence Y description 3'-nitrotyrosine => ECO:0007744|PubMed:16800626 source Swiss-Prot : SWS_FT_FI5 14) chain A residue 147-152 type prosite sequence LRGNHE description SER_THR_PHOSPHATASE Serine/threonine specific protein phosphatases signature. LRGNHE source prosite : PS00125 15) chain A residue 469 type MOD_RES sequence I description Phosphoserine => ECO:0000250|UniProtKB:P63329 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links