eF-site ID 4or2-A PDB Code 4or2 Chain A click to enlarge Title Human class C G protein-coupled metabotropic glutamate receptor 1 in complex with a negative allosteric modulator Classification SIGNALING PROTEIN Compound Soluble cytochrome b562, Metabotropic glutamate receptor 1 Source Homo sapiens (Human) (GRM1_HUMAN) Sequence A:  DLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQ KATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANE GKVKEAQAAAEQLKTTRNAYIQKYLIPVRYLEWSNIESII AIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIIL AGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSAL VTKTNRIARILARKPRFMSAWAQVIIASILISVQLTLVVT LIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLL IMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVP IYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPE Description Functional site 1) chain A residue 664 type sequence V description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 2) chain A residue 668 type sequence S description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 3) chain A residue 756 type sequence P description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 4) chain A residue 757 type sequence L description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 5) chain A residue 760 type sequence N description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 6) chain A residue 794 type sequence T description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 7) chain A residue 797 type sequence I description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 8) chain A residue 798 type sequence W description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 9) chain A residue 801 type sequence F description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 10) chain A residue 805 type sequence Y description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 11) chain A residue 811 type sequence K description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 12) chain A residue 815 type sequence T description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 13) chain A residue 818 type sequence A description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 14) chain A residue 822 type sequence S description BINDING SITE FOR RESIDUE FM9 A 1901 source : AC1 15) chain A residue 597 type sequence I description BINDING SITE FOR RESIDUE CLR A 1902 source : AC2 16) chain A residue 646 type sequence F description BINDING SITE FOR RESIDUE CLR A 1902 source : AC2 17) chain A residue 597 type sequence I description BINDING SITE FOR RESIDUE CLR A 1903 source : AC3 18) chain A residue 598 type sequence A description BINDING SITE FOR RESIDUE CLR A 1903 source : AC3 19) chain A residue 602 type sequence L description BINDING SITE FOR RESIDUE CLR A 1903 source : AC3 20) chain A residue 588 type sequence W description BINDING SITE FOR RESIDUE CLR A 1904 source : AC4 21) chain A residue 639 type sequence F description BINDING SITE FOR RESIDUE CLR A 1904 source : AC4 22) chain A residue 646 type sequence F description BINDING SITE FOR RESIDUE CLR A 1904 source : AC4 23) chain A residue 650 type sequence A description BINDING SITE FOR RESIDUE CLR A 1905 source : AC5 24) chain A residue 653 type sequence T description BINDING SITE FOR RESIDUE CLR A 1905 source : AC5 25) chain A residue 810 type sequence Y description BINDING SITE FOR RESIDUE OLA A 1906 source : AC6 26) chain A residue 817 type sequence F description BINDING SITE FOR RESIDUE OLA A 1906 source : AC6 27) chain A residue 758 type sequence G description BINDING SITE FOR RESIDUE OLC A 1907 source : AC7 28) chain A residue 806 type sequence F description BINDING SITE FOR RESIDUE OLC A 1907 source : AC7 29) chain A residue 589 type sequence S description BINDING SITE FOR RESIDUE OLC A 1908 source : AC8 30) chain A residue 591 type sequence I description BINDING SITE FOR RESIDUE OLC A 1908 source : AC8 31) chain A residue 810 type sequence Y description BINDING SITE FOR RESIDUE PO4 B 1903 source : BC2 32) chain A residue 836 type sequence Y description BINDING SITE FOR RESIDUE OLC B 1904 source : BC3 33) chain A residue 616-629 type TOPO_DOM sequence LYRDTPVVKSSSRE description Cytoplasmic => ECO:0000269|PubMed:24603153 source Swiss-Prot : SWS_FT_FI3 34) chain A residue 681-703 type TOPO_DOM sequence RIARILARKPRFMSA description Cytoplasmic => ECO:0000269|PubMed:24603153 source Swiss-Prot : SWS_FT_FI3 35) chain A residue 773-785 type TOPO_DOM sequence KTRNVPANFNEAK description Cytoplasmic => ECO:0000269|PubMed:24603153 source Swiss-Prot : SWS_FT_FI3 36) chain A residue 651-658 type TOPO_DOM sequence KPTTTSCY description Extracellular => ECO:0000269|PubMed:24603153 source Swiss-Prot : SWS_FT_FI5 37) chain A residue 728-750 type TOPO_DOM sequence EPPMPILSYPSIKEVYLICNTSN description Extracellular => ECO:0000269|PubMed:24603153 source Swiss-Prot : SWS_FT_FI5 38) chain A residue 808-815 type TOPO_DOM sequence SNYKIITT description Extracellular => ECO:0000269|PubMed:24603153 source Swiss-Prot : SWS_FT_FI5 39) chain A residue 593-615 type TRANSMEM sequence SIIAIAFSCLGILVTLFVTLIFV description Helical; Name=1 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 630-650 type TRANSMEM sequence LCYIILAGIFLGYVCPFTLIA description Helical; Name=2 source Swiss-Prot : SWS_FT_FI4 41) chain A residue 659-680 type TRANSMEM sequence LQRLLVGLSSAMCYSALVTKTN description Helical; Name=3 source Swiss-Prot : SWS_FT_FI6 42) chain A residue 704-727 type TRANSMEM sequence WAQVIIASILISVQLTLVVTLIIM description Helical; Name=4 source Swiss-Prot : SWS_FT_FI7 43) chain A residue 751-772 type TRANSMEM sequence LGVVAPLGYNGLLIMSCTYYAF description Helical; Name=5 source Swiss-Prot : SWS_FT_FI8 44) chain A residue 786-807 type TRANSMEM sequence YIAFTMYTTCIIWLAFVPIYFG description Helical; Name=6 source Swiss-Prot : SWS_FT_FI9 45) chain A residue 816-840 type TRANSMEM sequence CFAVSLSVTVALGCMFTPKMYIIIA description Helical; Name=7 source Swiss-Prot : SWS_FT_FI10 46) chain A residue 781-791 type prosite sequence FNEAKYIAFTM description G_PROTEIN_RECEP_F3_3 G-protein coupled receptors family 3 signature 3. FNEAKyIAFTM source prosite : PS00981 47) chain A residue 1007 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1 48) chain A residue 1102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links