eF-site ID 4oee-A PDB Code 4oee Chain A click to enlarge Title Crystal Structure Analysis of FGF2-Disaccharide (S3I2) complex Classification PROTEIN BINDING Compound Fibroblast growth factor 2 Source (FGF2_HUMAN) Sequence A:  FPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDE CFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTG PGQKAILFLPMS Description Functional site 1) chain A residue 80-103 type prosite sequence GRLLASKSVTDECFFFERLESNNY description HBGF_FGF HBGF/FGF family signature. GrLlAsksvtd.ECfFfErlesnnY source prosite : PS00247 2) chain A residue 27 type BINDING sequence N description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 119 type SITE sequence K description Important for interaction with integrin => ECO:0000269|PubMed:28302677 source Swiss-Prot : SWS_FT_FI2 4) chain A residue 120 type SITE sequence R description Important for interaction with integrin => ECO:0000269|PubMed:28302677 source Swiss-Prot : SWS_FT_FI2 5) chain A residue 125 type SITE sequence K description Important for interaction with integrin => ECO:0000269|PubMed:28302677 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 73 type MOD_RES sequence Y description Phosphotyrosine; by TEC => ECO:0000269|PubMed:20230531 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 86 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) => ECO:0007744|PubMed:25114211 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links