eF-site ID 4o1t-A PDB Code 4o1t Chain A click to enlarge Title Crystal structure of murine neuroglobin mutant F106W Classification TRANSPORT PROTEIN Compound Neuroglobin Source Mus musculus (Mouse) (NGB_MOUSE) Sequence A:  RPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLF QYNGRQFSSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDL SSLEEYLTSLGRKHRAVGVRLSSWSTVGESLLYMLEKSLG PDFTPATRTAWSRLYGAVVQAMSRGWDG Description Functional site 1) chain A residue 31 type sequence L description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 2) chain A residue 38 type sequence L description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 3) chain A residue 41 type sequence L description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 4) chain A residue 42 type sequence F description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 5) chain A residue 44 type sequence Y description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 6) chain A residue 64 type sequence H description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 7) chain A residue 67 type sequence K description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 8) chain A residue 67 type sequence K description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 9) chain A residue 68 type sequence V description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 10) chain A residue 71 type sequence V description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 11) chain A residue 88 type sequence Y description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 12) chain A residue 92 type sequence L description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 13) chain A residue 96 type sequence H description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 14) chain A residue 99 type sequence V description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 15) chain A residue 101 type sequence V description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 16) chain A residue 109 type sequence V description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 17) chain A residue 19 type sequence S description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 18) chain A residue 20 type sequence P description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 19) chain A residue 21 type sequence L description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 20) chain A residue 22 type sequence E description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 21) chain A residue 66 type sequence R description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 22) chain A residue 64 type BINDING sequence H description distal binding residue; reversible => ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:15162488, ECO:0007744|PDB:1Q1F source Swiss-Prot : SWS_FT_FI1 23) chain A residue 96 type BINDING sequence H description proximal binding residue => ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:15162488, ECO:0000269|PubMed:15548613, ECO:0007744|PDB:1Q1F, ECO:0007744|PDB:1W92 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links