eF-site ID 4nj5-A PDB Code 4nj5 Chain A click to enlarge Title Crystal structure of SUVH9 Classification METAL BINDING PROTEIN Compound Probable histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH9 Source Arabidopsis thaliana (Mouse-ear cress) (SUVH9_ARATH) Sequence A:  PESERQFREHVRKTRMIYDSLRMFLMMEEAKRRARADGKA GKAGSMMRDCMLWMNRDKRIVGSIPGVQVGDIFFFRFELC VMGLHGHPQSGIDFLTGSLSSNGEPIATSVIVSGGDVIMY TGQGGQDRLGRQAEHQRLEGGNLAMERSMYYGIEVRVIRG LKYENEVSSRVYVYDGLFRIVDSWFDVGKSGFGVFKYRLE RIEGQAEMGSSVLKFARTLKTNPLSVRPRGYINFDISNGK ENVPVYLFNDIDSDQEPLYYEYLAQTSFPPGLFGNASGCD CVNGCGSGCLCEAKNSGEIAYDYNGTLIRQKPLIHECGSA CQCPPSCRNRVTQKGLRNRLEVFRSLETGWGVRSLDVLHA GAFICEYAGVALTREQANILTMNGDTLVYPARFSSARWED WGDLSQVLADFERPSYPDIPPVDFAMDVSKMRNVACYISH STDPNVIVQFVLHDHNSLMFPRVMLFAAENIPPMTELSLD YG Description Functional site 1) chain A residue 434 type sequence C description BINDING SITE FOR RESIDUE ZN A 801 source : AC1 2) chain A residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN A 801 source : AC1 3) chain A residue 472 type sequence C description BINDING SITE FOR RESIDUE ZN A 801 source : AC1 4) chain A residue 476 type sequence C description BINDING SITE FOR RESIDUE ZN A 801 source : AC1 5) chain A residue 440 type sequence C description BINDING SITE FOR RESIDUE ZN A 802 source : AC2 6) chain A residue 472 type sequence C description BINDING SITE FOR RESIDUE ZN A 802 source : AC2 7) chain A residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN A 802 source : AC2 8) chain A residue 482 type sequence C description BINDING SITE FOR RESIDUE ZN A 802 source : AC2 9) chain A residue 434 type sequence C description BINDING SITE FOR RESIDUE ZN A 803 source : AC3 10) chain A residue 436 type sequence C description BINDING SITE FOR RESIDUE ZN A 803 source : AC3 11) chain A residue 440 type sequence C description BINDING SITE FOR RESIDUE ZN A 803 source : AC3 12) chain A residue 444 type sequence C description BINDING SITE FOR RESIDUE ZN A 803 source : AC3 13) chain A residue 434 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 14) chain A residue 436 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 15) chain A residue 440 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 444 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 446 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 18) chain A residue 472 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 19) chain A residue 476 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 20) chain A residue 478 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 21) chain A residue 482 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links