eF-site ID 4nci-A
PDB Code 4nci
Chain A

click to enlarge
Title Crystal Structure of Pyrococcus furiosis Rad50 R805E mutation
Classification DNA BINDING PROTEIN
Compound DNA double-strand break repair Rad50 ATPase
Source Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (RAD50_PYRFU)
Sequence A:  MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLL
DAILVGLYWPLRIKDIKKDRDTYIDLIFEKDGTKYRITRR
FLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLI
PYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKIE
KVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRA
EENKVRLFVVWEGKERPLTFLSGGERIALGLAFELAMSLY
LAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVI
LVSHDEELKDAADHVIRISLENGSSKVEVVS
Description (1)  DNA double-strand break repair Rad50 ATPase

Display surface

Download
Links