eF-site ID 4n3e-N PDB Code 4n3e Chain N click to enlarge Title Crystal structure of Hyp-1, a St John's wort PR-10 protein, in complex with 8-anilino-1-naphthalene sulfonate (ANS) Classification PLANT PROTEIN Compound Phenolic oxidative coupling protein Source Hypericum perforatum (St. John's wort) (Q8H1L1_HYPPE) Sequence N:  MAAYTIVKEEESPIAPHRLFKALVLERHQVLVKAQPHVFK SGEIIEGDGGVGTVTKITFVDGHPLTYMLHKFDEIDAANF YCKYTLFEGDVLRDNIEKVVYEVKLEAVGGGSKGKITVTY HPKPGCTVNEEEVKIGEKKAYEFYKQVEEYLAANPEVFA Description Functional site 1) chain N residue 110 type sequence G description BINDING SITE FOR RESIDUE 2AN B 204 source : AC8 2) chain N residue 27 type sequence R description BINDING SITE FOR RESIDUE 2AN N 201 source : FC5 3) chain N residue 31 type sequence L description BINDING SITE FOR RESIDUE 2AN N 201 source : FC5 4) chain N residue 35 type sequence Q description BINDING SITE FOR RESIDUE 2AN N 201 source : FC5 5) chain N residue 39 type sequence F description BINDING SITE FOR RESIDUE 2AN N 201 source : FC5 6) chain N residue 59 type sequence F description BINDING SITE FOR RESIDUE 2AN N 201 source : FC5 7) chain N residue 68 type sequence M description BINDING SITE FOR RESIDUE 2AN N 201 source : FC5 8) chain N residue 132 type sequence E description BINDING SITE FOR RESIDUE 2AN N 201 source : FC5 9) chain N residue 136 type sequence G description BINDING SITE FOR RESIDUE 2AN N 201 source : FC5 10) chain N residue 8 type sequence K description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 11) chain N residue 10 type sequence E description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 12) chain N residue 19 type sequence L description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 13) chain N residue 23 type sequence L description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 14) chain N residue 103 type sequence V description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 15) chain N residue 116 type sequence I description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 16) chain N residue 140 type sequence A description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 17) chain N residue 141 type sequence Y description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 18) chain N residue 144 type sequence Y description BINDING SITE FOR RESIDUE 2AN N 202 source : FC6 19) chain N residue 138 type sequence K description BINDING SITE FOR RESIDUE 2AN N 203 source : FC7 20) chain N residue 141 type sequence Y description BINDING SITE FOR RESIDUE 2AN N 203 source : FC7 21) chain N residue 141 type sequence Y description BINDING SITE FOR RESIDUE 2AN N 204 source : FC8

Display surface Download Links