eF-site ID 4n19-A PDB Code 4n19 Chain A click to enlarge Title Structural basis of conformational transitions in the active site and 80 s loop in the FK506 binding protein FKBP12 Classification ISOMERASE Compound Peptidyl-prolyl cis-trans isomerase FKBP1A Source Homo sapiens (Human) (FKB1A_HUMAN) Sequence A:  GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSR DRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDY AYGATGHPPIIPPHATLVFDVELLKLE Description Functional site 1) chain A residue 83 type sequence G description BINDING SITE FOR RESIDUE SO4 A 201 source : AC1 2) chain A residue 84 type sequence A description BINDING SITE FOR RESIDUE SO4 A 201 source : AC1 3) chain A residue 84 type sequence A description BINDING SITE FOR RESIDUE SO4 A 201 source : AC1 4) chain A residue 85 type sequence T description BINDING SITE FOR RESIDUE SO4 A 201 source : AC1 5) chain A residue 52 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P26883 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 26 type catalytic sequence Y description 362 source MCSA : MCSA1 7) chain A residue 36 type catalytic sequence F description 362 source MCSA : MCSA1 8) chain A residue 37 type catalytic sequence D description 362 source MCSA : MCSA1 9) chain A residue 56 type catalytic sequence I description 362 source MCSA : MCSA1 10) chain A residue 82 type catalytic sequence Y description 362 source MCSA : MCSA1 11) chain A residue 99 type catalytic sequence F description 362 source MCSA : MCSA1

Display surface Download Links