eF-site ID 4mv7-A PDB Code 4mv7 Chain A click to enlarge Title Crystal Structure of Biotin Carboxylase form Haemophilus influenzae in Complex with Phosphonoformate Classification LIGASE Compound Biotin carboxylase Source Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (ACCC_HAEIN) Sequence A:  MLEKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLK HVLLADETICIGPAPSAKSYLNIPAIIAAAEVTGADAIHP GYGFLSENADFAEQVERSGFTFIGPTADVIRLMGDKVSAI KAMKKAGVPCVPGSAKNKEIAKRIGYPIIIRVVRSEDALE ESIAMTKAEMEKYLENPRHVEIQVLADTHGNAVYLAERDC SMQRRHQKVVEEAPAPGITEEVRRDIGSRCANACVEIGYR GAGTFEFLYENGEFYFIEMNTRIQVEHPVTEMITGVDLVK EQLRIAAGLPISFKQEDIKVKGHAMECRINAEDPKTFLPS PGKVNHLHSPGGLGVRWDSHVYGGYTVPPHYDSMIAKLIT YGDTREVAIRRMQNALSETIIDGIKTNIPLHELILEDENF QKGGTNIHYLEKKL Description Functional site 1) chain A residue 238 type sequence K description BINDING SITE FOR RESIDUE PPF A 501 source : AC1 2) chain A residue 290 type sequence N description BINDING SITE FOR RESIDUE PPF A 501 source : AC1 3) chain A residue 292 type sequence R description BINDING SITE FOR RESIDUE PPF A 501 source : AC1 4) chain A residue 294 type sequence Q description BINDING SITE FOR RESIDUE PPF A 501 source : AC1 5) chain A residue 295 type sequence V description BINDING SITE FOR RESIDUE PPF A 501 source : AC1 6) chain A residue 296 type sequence E description BINDING SITE FOR RESIDUE PPF A 501 source : AC1 7) chain A residue 338 type sequence R description BINDING SITE FOR RESIDUE PPF A 501 source : AC1 8) chain A residue 1 type sequence M description BINDING SITE FOR RESIDUE EDO A 502 source : AC2 9) chain A residue 2 type sequence L description BINDING SITE FOR RESIDUE EDO A 502 source : AC2 10) chain A residue 359 type sequence S description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 11) chain A residue 359 type sequence S description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 12) chain A residue 360 type sequence P description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 13) chain A residue 360 type sequence P description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 14) chain A residue 361 type sequence G description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 15) chain A residue 367 type sequence W description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 16) chain A residue 367 type sequence W description BINDING SITE FOR RESIDUE EDO A 503 source : AC3 17) chain A residue 292 type ACT_SITE sequence R description ACT_SITE => ECO:0000250|UniProtKB:P24182 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 286-293 type prosite sequence FIEMNTRI description CPSASE_2 Carbamoyl-phosphate synthase subdomain signature 2. FIEMNTRI source prosite : PS00867 19) chain A residue 209 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P24182 source Swiss-Prot : SWS_FT_FI4 20) chain A residue 236 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P24182 source Swiss-Prot : SWS_FT_FI4 21) chain A residue 238 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:P24182 source Swiss-Prot : SWS_FT_FI4 22) chain A residue 292 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P24182 source Swiss-Prot : SWS_FT_FI4 23) chain A residue 295 type BINDING sequence V description BINDING => ECO:0000250|UniProtKB:P24182 source Swiss-Prot : SWS_FT_FI4 24) chain A residue 338 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P24182 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 201 type BINDING sequence E description BINDING => ECO:0000269|PubMed:26020841, ECO:0007744|PDB:4MV1, ECO:0007744|PDB:4MV3, ECO:0007744|PDB:4MV4, ECO:0007744|PDB:4MV8, ECO:0007744|PDB:4RZQ source Swiss-Prot : SWS_FT_FI5 26) chain A residue 288 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00409 source Swiss-Prot : SWS_FT_FI6 27) chain A residue 290 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00409 source Swiss-Prot : SWS_FT_FI6 28) chain A residue 276 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00409 source Swiss-Prot : SWS_FT_FI6 29) chain A residue 116 type BINDING sequence K description BINDING => ECO:0000269|PubMed:26020841, ECO:0007744|PDB:4MV8 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links