eF-site ID 4msv-AB
PDB Code 4msv
Chain A, B

click to enlarge
Title Crystal structure of FASL and DcR3 complex
Classification IMMUNE SYSTEM
Compound Tumor necrosis factor receptor superfamily member 6B
Source Homo sapiens (Human) (TNFL6_HUMAN)
Sequence A:  LRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLV
INETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDL
VMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVS
ELSLVNFEESQTFFGLYKL
B:  TPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDSPTTCGP
CPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRA
CRCRTGFFAHAGFCLEHASCPPGAGVIAPGTPSQNTQCQP
CPPGTFSASSSSSEQCQPHRNCTALLALNVPGSSSHDTLC
Description (1)  Tumor necrosis factor receptor superfamily member 6B, Tumor necrosis factor ligand superfamily member 6


Functional site

1) chain B
residue 132
type
ligand
sequence C
description BINDING SITE FOR RESIDUE MG B 301
source : AC1

2) chain B
residue 133
type
ligand
sequence P
description BINDING SITE FOR RESIDUE MG B 301
source : AC1

3) chain B
residue 136
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MG B 301
source : AC1

4) chain B
residue 159
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG B 301
source : AC1

5) chain B
residue 161
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG B 301
source : AC1

6) chain A
residue 215
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

7) chain A
residue 218
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

8) chain A
residue 220
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

9) chain A
residue 222
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

10) chain B
residue 85
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

11) chain B
residue 89
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

12) chain B
residue 85
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_4msv_A_301

13) chain B
residue 89
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_4msv_A_301

14) chain A
residue 213-215
type binding
ligand GOL: GLYCEROL
sequence MRN
description GLYCEROL binding site
source pdb_hetatom : GOL_4msv_A_301

15) chain A
residue 218-222
type binding
ligand GOL: GLYCEROL
sequence YPQDL
description GLYCEROL binding site
source pdb_hetatom : GOL_4msv_A_301


Display surface

Download
Links