eF-site ID 4msv-A
PDB Code 4msv
Chain A

click to enlarge
Title Crystal structure of FASL and DcR3 complex
Classification IMMUNE SYSTEM
Compound Tumor necrosis factor receptor superfamily member 6B
Source Homo sapiens (Human) (TNFL6_HUMAN)
Sequence A:  LRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLV
INETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDL
VMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVS
ELSLVNFEESQTFFGLYKL
Description (1)  Tumor necrosis factor receptor superfamily member 6B, Tumor necrosis factor ligand superfamily member 6


Functional site

1) chain A
residue 215
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

2) chain A
residue 218
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

3) chain A
residue 220
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

4) chain A
residue 222
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL A 301
source : AC2

5) chain A
residue 213-215
type binding
ligand GOL: GLYCEROL
sequence MRN
description GLYCEROL binding site
source pdb_hetatom : GOL_4msv_A_301

6) chain A
residue 218-222
type binding
ligand GOL: GLYCEROL
sequence YPQDL
description GLYCEROL binding site
source pdb_hetatom : GOL_4msv_A_301


Display surface

Download
Links