eF-site ID 4miw-A PDB Code 4miw Chain A click to enlarge Title High-resolution structure of the N-terminal endonuclease domain of the Lassa virus L polymerase Classification Viral Protein, Transferase Compound RNA-directed RNA polymerase L Source (Q6GWS2_9VIRU) Sequence A:  MEEDIACVKDLVSKYLVDNERLSRQKLAFLVQTEPRMLLM EGLKLLSLCIEVDSCNANGCEHNSEDKSVERILHDHGILT PSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDF KKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKL RDTLFSLLKY Description Functional site 1) chain A residue 89 type sequence D description BINDING SITE FOR RESIDUE MG A 201 source : AC1 2) chain A residue 103 type sequence C description BINDING SITE FOR RESIDUE MG A 201 source : AC1 3) chain A residue 89 type sequence D description BINDING SITE FOR RESIDUE MG A 202 source : AC2

Display surface Download Links