eF-site ID 4mha-A PDB Code 4mha Chain A click to enlarge Title Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with inhibitor UNC1817 Classification TRANSFERASE/TRANSFERASE INHIBITOR Compound Tyrosine-protein kinase Mer Source Homo sapiens (Human) (MERTK_HUMAN) Sequence A:  VVIDRNLLILGKILGEGSVMEGNLKQEDGTSLKVAVKTMK LDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEPKPM VILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIA LGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGPVKWI AIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNH EMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTF SVLRLQLEKLLESLPD Description Functional site 1) chain A residue 797 type sequence G description BINDING SITE FOR RESIDUE CL A 901 source : AC1 2) chain A residue 802 type sequence P description BINDING SITE FOR RESIDUE CL A 902 source : AC2 3) chain A residue 819 type sequence L description BINDING SITE FOR RESIDUE CL A 902 source : AC2 4) chain A residue 820 type sequence K description BINDING SITE FOR RESIDUE CL A 902 source : AC2 5) chain A residue 584 type sequence R description BINDING SITE FOR RESIDUE CL A 903 source : AC3 6) chain A residue 589 type sequence L description BINDING SITE FOR RESIDUE CL A 903 source : AC3 7) chain A residue 593 type sequence L description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 8) chain A residue 617 type sequence A description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 9) chain A residue 650 type sequence I description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 10) chain A residue 672 type sequence P description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 11) chain A residue 673 type sequence F description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 12) chain A residue 674 type sequence M description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 13) chain A residue 675 type sequence K description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 14) chain A residue 677 type sequence G description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 15) chain A residue 730 type sequence M description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 16) chain A residue 741 type sequence D description BINDING SITE FOR RESIDUE 4MH A 904 source : AC4 17) chain A residue 723 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 593 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 615 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 593-619 type prosite sequence LGEGSVMEGNLKQEDGTSLKVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGEGEFGSVMeGnlkqedgtslk.......VAVK source prosite : PS00107 21) chain A residue 719-731 type prosite sequence FLHRDLAARNCML description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FLHrDLAARNCML source prosite : PS00109

Display surface Download Links