eF-site ID 4m7m-A PDB Code 4m7m Chain A click to enlarge Title Crystal structure of the R111K:R132Q:Y134F:T54V:R59W:A32W mutant of the Cellular Retinoic Acid Binding Protein Type II in complex with All-Trans Retinal at 2.57 Angstrom Resolution Classification TRANSPORT PROTEIN Compound Cellular retinoic acid-binding protein 2 Source Homo sapiens (Human) (RABP2_HUMAN) Sequence A:  PNFSGNWKIIRSENFEELLKVLGVNVMLRKIWVAAASKPA VEIKQEGDTFYIKVSTTVWTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELI LTMTADDVVCTQVFVRE Description (1)  Cellular retinoic acid-binding protein 2 Functional site 1) chain A residue 15 type sequence F description BINDING SITE FOR RESIDUE RET A 201 source : AC1 2) chain A residue 27 type sequence M description BINDING SITE FOR RESIDUE RET A 201 source : AC1 3) chain A residue 32 type sequence W description BINDING SITE FOR RESIDUE RET A 201 source : AC1 4) chain A residue 36 type sequence A description BINDING SITE FOR RESIDUE RET A 201 source : AC1 5) chain A residue 39 type sequence P description BINDING SITE FOR RESIDUE RET A 201 source : AC1 6) chain A residue 52 type sequence I description BINDING SITE FOR RESIDUE RET A 201 source : AC1 7) chain A residue 76 type sequence V description BINDING SITE FOR RESIDUE RET A 201 source : AC1 8) chain A residue 109 type sequence W description BINDING SITE FOR RESIDUE RET A 201 source : AC1 9) chain A residue 111 type sequence K description BINDING SITE FOR RESIDUE RET A 201 source : AC1 10) chain A residue 121 type sequence L description BINDING SITE FOR RESIDUE RET A 201 source : AC1 11) chain A residue 123 type sequence M description BINDING SITE FOR RESIDUE RET A 201 source : AC1 12) chain A residue 101 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:21998312 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 132 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:16979656, ECO:0007744|PDB:2FR3 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 5-22 type prosite sequence GNWKIIRSENFEELLKVL description FABP Cytosolic fatty-acid binding proteins signature. GNWkIirSeNFEeLLKVL source prosite : PS00214

Display surface Download Links