eF-site ID 4ljo-A PDB Code 4ljo Chain A click to enlarge Title Structure of an active ligase (HOIP)/ubiquitin transfer complex Classification LIGASE Compound E3 ubiquitin-protein ligase RNF31 Source ORGANISM_COMMON: bovine,cow,domestic cattle,domestic cow; ORGANISM_SCIENTIFIC: Bos taurus; Sequence A:  AQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQ FCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRD WTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKE VPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLD PATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQK LTEEVPLGQSIPRRRK Description Functional site 1) chain A residue 871 type sequence C description BINDING SITE FOR RESIDUE ZN A 1101 source : AC1 2) chain A residue 874 type sequence C description BINDING SITE FOR RESIDUE ZN A 1101 source : AC1 3) chain A residue 890 type sequence C description BINDING SITE FOR RESIDUE ZN A 1101 source : AC1 4) chain A residue 893 type sequence C description BINDING SITE FOR RESIDUE ZN A 1101 source : AC1 5) chain A residue 898 type sequence C description BINDING SITE FOR RESIDUE ZN A 1102 source : AC2 6) chain A residue 901 type sequence C description BINDING SITE FOR RESIDUE ZN A 1102 source : AC2 7) chain A residue 926 type sequence H description BINDING SITE FOR RESIDUE ZN A 1102 source : AC2 8) chain A residue 930 type sequence C description BINDING SITE FOR RESIDUE ZN A 1102 source : AC2 9) chain A residue 911 type sequence C description BINDING SITE FOR RESIDUE ZN A 1103 source : AC3 10) chain A residue 916 type sequence C description BINDING SITE FOR RESIDUE ZN A 1103 source : AC3 11) chain A residue 923 type sequence H description BINDING SITE FOR RESIDUE ZN A 1103 source : AC3 12) chain A residue 925 type sequence H description BINDING SITE FOR RESIDUE ZN A 1103 source : AC3 13) chain A residue 969 type sequence C description BINDING SITE FOR RESIDUE ZN A 1104 source : AC4 14) chain A residue 986 type sequence C description BINDING SITE FOR RESIDUE ZN A 1104 source : AC4 15) chain A residue 998 type sequence C description BINDING SITE FOR RESIDUE ZN A 1104 source : AC4 16) chain A residue 1001 type sequence H description BINDING SITE FOR RESIDUE ZN A 1104 source : AC4 17) chain A residue 885 type sequence C description BINDING SITE FOR RESIDUE IMD A 1105 source : AC5 18) chain A residue 887 type sequence H description BINDING SITE FOR RESIDUE IMD A 1105 source : AC5 19) chain A residue 885 type sequence C description BINDING SITE FOR RESIDUE ZN A 1106 source : AC6 20) chain A residue 887 type sequence H description BINDING SITE FOR RESIDUE ZN A 1106 source : AC6 21) chain A residue 874 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI3 22) chain A residue 890 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI3 23) chain A residue 893 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 898 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI3 25) chain A residue 901 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI3 26) chain A residue 916 type MOD_RES sequence C description Phosphoserine; by PINK1 => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI3 27) chain A residue 925 type MOD_RES sequence H description Phosphoserine; by PINK1 => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI3 28) chain A residue 893-902 type prosite sequence CRHQFCSGCY description ZF_RING_1 Zinc finger RING-type signature. CrHqFCsgCY source prosite : PS00518

Display surface Download Links