eF-site ID 4lgd-A PDB Code 4lgd Chain A click to enlarge Title Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5 Classification SIGNALING PROTEIN Compound Serine/threonine-protein kinase 3 Source Homo sapiens (Human) (RASF5_HUMAN) Sequence A:  EDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAI KQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDL WIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLE YLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTM AKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMA EGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFV KKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAM EIKAKRHEEQQRELEEEEFDFLKNLSLEELQMRLKALDPM MEREIEELRQRYTAKRQPILDAMDAKKRRQ Description Functional site 1) chain A residue 33 type sequence L description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 2) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 3) chain A residue 36 type sequence G description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 4) chain A residue 41 type sequence V description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 5) chain A residue 54 type sequence A description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 6) chain A residue 56 type sequence K description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 7) chain A residue 99 type sequence M description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 8) chain A residue 100 type sequence E description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 9) chain A residue 102 type sequence C description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 10) chain A residue 109 type sequence D description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 11) chain A residue 164 type sequence D description BINDING SITE FOR RESIDUE ANP A 501 source : AC1 12) chain A residue 164 type sequence D description BINDING SITE FOR RESIDUE MG A 502 source : AC2 13) chain A residue 145 type sequence R description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 14) chain A residue 168 type sequence A description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 15) chain A residue 169 type sequence G description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 16) chain A residue 197 type sequence G description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 17) chain A residue 198 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 503 source : AC3 18) chain A residue 174 type MOD_RES sequence T description Phosphothreonine; by autocatalysis => ECO:0000269|PubMed:23972470 source Swiss-Prot : SWS_FT_FI7 19) chain A residue 180 type MOD_RES sequence T description Phosphothreonine; by autocatalysis => ECO:0000269|PubMed:23972470 source Swiss-Prot : SWS_FT_FI7 20) chain A residue 450 type MOD_RES sequence M description Phosphothreonine => ECO:0007744|PubMed:19369195, ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI9 21) chain A residue 146 type ACT_SITE sequence N description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 33 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 117 type MOD_RES sequence T description Phosphothreonine; by PKB/AKT1 => ECO:0000269|PubMed:20086174, ECO:0000269|PubMed:20231902 source Swiss-Prot : SWS_FT_FI6 24) chain A residue 33-56 type prosite sequence LGEGSYGSVFKAIHKESGQVVAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGEGSYGSVFkAihkesgqv..........VAIK source prosite : PS00107 25) chain A residue 56 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links